SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.
Simc does not support overlapping add spawning in a single raid event (duration of 44.000s > reasonable minimum cooldown of 15.000s).
close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 38.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Raid Event List
0 adds,name=Pack_Beast,count=6,first=15,duration=10,cooldown=30,angle_start=0,angle_end=360,distance=3
1 adds,name=Heavy_Spear,count=2,first=15,duration=15,cooldown=20,spawn_x=-15,spawn_y=0,distance=15
2 movement,first=13,distance=5,cooldown=20,players_only=1,player_chance=0.1
3 adds,name=Beast,count=1,first=10,duration=44,cooldown=75,last=195,duration_stddev=5,cooldown_stddev=10

Actions per Minute / DPS Variance Summary

1ilevel : 2099801 dps, 966244 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2099801.4 2099801.4 2517.9 / 0.120% 441908.6 / 21.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
1ilevel 2099801
Chain Lightning 200450 (436853) 9.6% (20.9%) 44.7 5.95sec 2943328 2356809 Direct 175.8 244609 675039 342995 22.9%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.66 175.84 0.00 0.00 1.2489 0.0000 60311774.45 60311774.45 0.00 2356808.83 2356808.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.64 77.14% 244608.84 147748 578645 245137.05 166962 314379 33179901 33179901 0.00
crit 40.19 22.86% 675039.48 408966 1601688 676083.68 449831 991261 27131873 27131873 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 236404 11.3% 54.1 8.90sec 1315625 0 Direct 239.4 211845 584040 297145 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.07 239.42 0.00 0.00 0.0000 0.0000 71141595.11 71141595.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.55 77.08% 211845.05 124108 486062 212158.65 136421 297634 39096699 39096699 0.00
crit 54.87 22.92% 584039.53 343531 1345418 584940.85 377867 906991 32044896 32044896 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67180 3.2% 10.1 29.93sec 2003356 2104326 Direct 10.1 1422225 3944738 2003468 23.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.07 10.07 0.00 0.00 0.9520 0.0000 20172070.51 20172070.51 0.00 2104326.15 2104326.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 76.96% 1422225.39 102653 1675140 1424212.32 629775 1652853 11021077 11021077 0.00
crit 2.32 23.04% 3944737.74 284143 4636788 3628384.63 0 4636788 9150993 9150993 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (771269) 0.0% (36.8%) 50.5 5.54sec 4581458 4682876

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.48 0.00 0.00 0.00 0.9784 0.0000 0.00 0.00 0.00 4682875.84 4682875.84
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 570654 27.2% 299.4 0.93sec 571400 0 Direct 1535.1 79938 221315 111459 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.45 1535.12 0.00 0.00 0.0000 0.0000 171102958.10 171102958.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1192.86 77.70% 79937.67 68814 89835 79973.63 75974 84504 95354671 95354671 0.00
crit 342.26 22.30% 221314.75 190476 248662 221410.39 209720 233872 75748287 75748287 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 200615 9.6% 76.9 4.16sec 782362 0 Direct 76.9 560840 1552599 782346 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.89 76.89 0.00 0.00 0.0000 0.0000 60156182.50 60156182.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.72 77.66% 560839.62 538658 601032 560971.46 544655 584969 33491626 33491626 0.00
crit 17.17 22.34% 1552598.73 1491004 1663656 1552965.74 1497645 1633110 26664557 26664557 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57271 (87619) 2.7% (4.2%) 20.0 15.23sec 1312082 993773 Direct 20.0 609841 1689360 857602 22.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.3203 0.0000 17175601.84 17175601.84 0.00 993772.74 993772.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 77.05% 609841.24 523267 683116 609974.19 549576 651608 9411059 9411059 0.00
crit 4.60 22.95% 1689360.46 1448404 1890864 1677795.77 0 1890864 7764543 7764543 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30348 1.4% 12.7 23.15sec 719406 0 Direct 12.7 512551 1417528 719470 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.65 12.65 0.00 0.00 0.0000 0.0000 9102730.73 9102730.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.76 77.14% 512550.96 439545 573817 512668.14 458524 573817 5003021 5003021 0.00
crit 2.89 22.86% 1417527.78 1216660 1588326 1352769.96 0 1588326 4099710 4099710 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 87060 4.1% 26.4 11.39sec 986851 1026670 Direct 26.4 92861 257598 130760 23.0%  
Periodic 316.1 50888 140857 71565 23.0% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.42 26.42 316.07 316.07 0.9613 1.2635 26074347.85 26074347.85 0.00 61389.40 1026670.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.34 77.00% 92861.37 78137 102006 92731.42 83806 97304 1889148 1889148 0.00
crit 6.08 23.00% 257598.06 216282 282352 256414.53 0 282352 1565682 1565682 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.4 77.02% 50887.81 36 56104 50858.42 46566 53249 12387454 12387454 0.00
crit 72.6 22.98% 140857.05 99 155296 140773.30 126641 147915 10232064 10232064 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65372 (147758) 3.1% (6.9%) 7.6 28.44sec 5789008 4947540 Direct 36.4 383457 1052410 531741 22.2%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 36.37 0.00 0.00 1.1701 0.0000 19339303.34 19339303.34 0.00 4947539.54 4947539.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 77.83% 383456.85 175805 1008077 384484.18 220612 578192 10854671 10854671 0.00
crit 8.06 22.17% 1052410.02 486629 2790358 1047892.01 0 2612156 8484633 8484633 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82386 3.9% 11.2 40.26sec 2178765 0 Direct 55.1 317224 879640 442623 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 55.06 0.00 0.00 0.0000 0.0000 24372208.46 24372208.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.79 77.70% 317223.61 147675 846778 317927.89 174027 670037 13571932 13571932 0.00
crit 12.28 22.30% 879639.79 408765 2343882 882248.44 426970 1970515 10800276 10800276 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast4
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162571 (264531) 7.7% (12.6%) 57.7 5.13sec 1372034 1209908 Direct 57.7 264653 843242 843216 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.65 57.65 0.00 0.00 1.1340 0.0000 48614046.56 48614046.56 0.00 1209907.96 1209907.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 264653.11 227895 297512 691.81 0 297512 692 692 0.00
crit 57.65 100.00% 843242.45 695280 1169199 843777.97 800217 893733 48613355 48613355 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83370 4.0% 36.6 8.05sec 680898 0 Direct 36.6 222885 680925 680900 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.62 36.62 0.00 0.00 0.0000 0.0000 24933614.23 24933614.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 222885.39 199958 249910 436.97 0 249910 437 437 0.00
crit 36.62 99.99% 680924.62 561738 944630 681396.06 632237 747129 24933177 24933177 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18590 0.9% 43.2 6.28sec 128442 0 Direct 99.6 44938 91642 55786 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.25 99.58 0.00 0.00 0.0000 0.0000 5554911.95 5554911.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.45 76.77% 44938.06 43108 48099 44940.96 43108 47581 3435450 3435450 0.00
crit 23.13 23.23% 91641.72 87940 98122 91642.52 0 98122 2119462 2119462 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49696 (96637) 2.4% (4.6%) 41.0 7.15sec 708349 583436 Direct 41.0 227690 633334 364365 33.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.03 41.03 0.00 0.00 1.2141 0.0000 14950326.96 14950326.96 0.00 583436.15 583436.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.20 66.30% 227690.11 154866 606522 228796.02 170838 366400 6194423 6194423 0.00
crit 13.83 33.70% 633334.46 428668 1678852 635685.42 454046 1222811 8755904 8755904 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46941 2.2% 46.0 8.51sec 306660 0 Direct 46.0 192245 534611 306669 33.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.02 46.02 0.00 0.00 0.0000 0.0000 14113544.81 14113544.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.64 66.58% 192245.42 130087 509478 192642.58 144799 344843 5890632 5890632 0.00
crit 15.38 33.42% 534611.39 360081 1410235 536060.76 389039 1093949 8222912 8222912 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (60105) 0.0% (2.8%) 3.0 120.34sec 5994050 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.97 0.00 0.0000 1.0000 0.00 0.00 0.00 308719.10 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19350 0.9% 38.1 6.92sec 151177 0 Direct 38.1 121869 248614 151178 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.10 38.10 0.00 0.00 0.0000 0.0000 5760559.92 5760559.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.29 76.88% 121869.49 121869 121869 121869.49 121869 121869 3570023 3570023 0.00
crit 8.81 23.12% 248613.77 248614 248614 248613.77 248614 248614 2190537 2190537 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40755 1.9% 99.2 2.61sec 122398 0 Direct 99.2 98655 201256 122399 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.15 99.15 0.00 0.00 0.0000 0.0000 12136195.07 12136195.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.21 76.86% 98654.92 98655 98655 98654.92 98655 98655 7518328 7518328 0.00
crit 22.95 23.14% 201256.04 201256 201256 201256.04 201256 201256 4617867 4617867 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143635 / 55544
Fire Blast 143635 2.6% 63.2 4.27sec 261769 146262 Direct 63.2 213041 426166 261763 22.9%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.22 63.22 0.00 0.00 1.7897 0.0000 16548259.66 16548259.66 0.00 146262.27 146262.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.76 77.14% 213041.18 199777 222910 213040.35 208279 219728 10388699 10388699 0.00
crit 14.45 22.86% 426166.26 399554 445820 426144.53 415124 445820 6159561 6159561 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186019 / 25246
Lightning Blast 186019 1.2% 40.0 7.05sec 189290 201840 Direct 40.0 154315 308731 189292 22.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.01 40.01 0.00 0.00 0.9378 0.0000 7573227.74 7573227.74 0.00 201839.71 201839.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.95 77.35% 154315.50 147983 165119 154357.01 149395 162388 4775606 4775606 0.00
crit 9.06 22.65% 308731.13 295966 330237 308799.44 295966 330237 2797622 2797622 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
1ilevel
Ascendance 2.0 181.62sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0338 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.20sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8137 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5092 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.73% 0.0(0.0) 2.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.01% 32.01% 3.1(3.1) 7.9

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.3sec 69.3sec 8.68% 8.68% 0.0(0.0) 3.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.5sec 25.6sec 31.68% 31.68% 1.3(1.3) 9.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.6sec 31.52% 31.52% 1.3(1.3) 9.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.6sec 30.50% 30.50% 1.6(1.6) 8.9

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.50%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.8 3.8sec 2.8sec 73.75% 68.29% 28.8(28.8) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.95%
  • elemental_focus_2:52.80%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.4 7.2 11.9sec 9.1sec 25.67% 42.97% 7.2(7.3) 1.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.67%

Trigger Attempt Success

  • trigger_pct:99.82%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 29.88% 29.88% 4.3(4.3) 12.6

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 84.8sec 84.8sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.53%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.6sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 45.8sec 31.6sec 31.35% 38.56% 2.4(6.0) 2.1

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.92%
  • power_of_the_maelstrom_2:7.11%
  • power_of_the_maelstrom_3:18.32%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.3 0.0 44.0sec 44.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.12%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.2sec 11.31% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.61%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.7 9.1sec
Lava Surge: Wasted 7.3 30.5sec
Lava Surge: During Lava Burst 4.4 53.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6200.00116.65115.9530.00019.745
Fire Elemental0.3290.0011.7650.0950.0001.765
Ascendance1.8850.0018.8911.6610.0008.891
Lava Burst2.9240.00136.09044.3607.996100.136
Elemental Blast2.1190.00118.47935.54819.64767.204

Resources

Resource Usage Type Count Total Average RPE APR
1ilevel
earth_shock Maelstrom 76.1 9032.3 118.7 897.0 2233.3
earthquake Maelstrom 381.7 19083.0 50.0 378.1 12118.6
flame_shock Maelstrom 199.8 3780.5 18.9 143.1 6897.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 435.91 5175.37 (16.05%) 11.87 55.53 1.06%
Lava Burst Overload Maelstrom 276.86 2425.25 (7.52%) 8.76 66.47 2.67%
Lava Beam Maelstrom 57.09 1606.88 (4.98%) 28.15 42.85 2.60%
Lava Beam Overload Maelstrom 84.58 1588.98 (4.93%) 18.79 76.51 4.59%
Chain Lightning Maelstrom 337.67 7833.13 (24.29%) 23.20 143.57 1.80%
Chain Lightning Overload Maelstrom 408.88 6846.81 (21.23%) 16.75 394.72 5.45%
Lightning Bolt Maelstrom 310.21 2472.57 (7.67%) 7.97 9.09 0.37%
Lightning Bolt Overload Maelstrom 347.96 2067.65 (6.41%) 5.94 20.14 0.96%
Resonance Totem Maelstrom 2257.77 2229.05 (6.91%) 0.99 28.72 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.22 14.06
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.44 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 1ilevel Fight Length
Count 7651
Mean 300.01
Minimum 239.95
Maximum 360.04
Spread ( max - min ) 120.09
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.7582
5th Percentile 245.95
95th Percentile 354.04
( 95th Percentile - 5th Percentile ) 108.09
Mean Distribution
Standard Deviation 0.3974
95.00% Confidence Intervall ( 299.23 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 516
0.1% Error 51565
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
Sample Data 1ilevel Damage Per Second
Count 7651
Mean 2099801.41
Minimum 1616376.25
Maximum 2538371.29
Spread ( max - min ) 921995.03
Range [ ( max - min ) / 2 * 100% ] 21.95%
Standard Deviation 112370.1307
5th Percentile 1921666.20
95th Percentile 2292957.46
( 95th Percentile - 5th Percentile ) 371291.26
Mean Distribution
Standard Deviation 1284.6706
95.00% Confidence Intervall ( 2097283.51 - 2102319.32 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11002
0.1 Scale Factor Error with Delta=300 107791730
0.05 Scale Factor Error with Delta=300 431166919
0.01 Scale Factor Error with Delta=300 10779172966
Priority Target DPS
Sample Data 1ilevel Priority Target Damage Per Second
Count 7651
Mean 966244.15
Minimum 816291.67
Maximum 1194374.91
Spread ( max - min ) 378083.24
Range [ ( max - min ) / 2 * 100% ] 19.56%
Standard Deviation 42270.6365
5th Percentile 899723.28
95th Percentile 1038127.22
( 95th Percentile - 5th Percentile ) 138403.94
Mean Distribution
Standard Deviation 483.2587
95.00% Confidence Intervall ( 965296.98 - 967191.32 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7352
0.1 Scale Factor Error with Delta=300 15253210
0.05 Scale Factor Error with Delta=300 61012840
0.01 Scale Factor Error with Delta=300 1525320982
DPS(e)
Sample Data 1ilevel Damage Per Second (Effective)
Count 7651
Mean 2099801.41
Minimum 1616376.25
Maximum 2538371.29
Spread ( max - min ) 921995.03
Range [ ( max - min ) / 2 * 100% ] 21.95%
Damage
Sample Data 1ilevel Damage
Count 7651
Mean 605011972.39
Minimum 426334763.68
Maximum 813578432.35
Spread ( max - min ) 387243668.67
Range [ ( max - min ) / 2 * 100% ] 32.00%
DTPS
Sample Data 1ilevel Damage Taken Per Second
Count 7651
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 1ilevel Healing Per Second
Count 7651
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 1ilevel Healing Per Second (Effective)
Count 7651
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 1ilevel Heal
Count 7651
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 1ilevel Healing Taken Per Second
Count 7651
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 1ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 1ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 1ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.99 totem_mastery,if=buff.resonance_totem.remains<2
9 1.98 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.95 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.88 stormkeeper
G 0.16 ascendance
0.00 liquid_magma_totem
H 2.00 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.89 earthquake
J 1.62 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.67 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.46 lava_beam
M 35.97 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.82 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.02 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.78 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.24 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.82 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.02 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 55.54 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.08 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.75 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.28 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.84 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.95 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.38 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddWPWWWTWWSLIILILIIILIWWXSXbbbdWcXYWXcWSWWIMIMMIMIIMMWSWWTUVVWWXXSccWWIIMMIMIIMSWWbbTbcWWcSYcQWMIMMIIMISW8WbAWbTWdddQSddWdTFMIIMIMIMSWWXbWXbWXXSbbWTMMIIMMIIRSWWXXWccTWWPWSWWWIFILLIILSW97WWdYQWXbWSWXbWIMIMIIIMIMIK8MIMMIAMIMMIIKQWWMIIFMIIMMSTWWddddWXXSddXWIIMIMMIIMJIKM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.963 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.051 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.087 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.866 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.644 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.424 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.203 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.981 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.981 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.016 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.051 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.067 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.830 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.846 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.912 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.021 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.039 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.803 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.582 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.619 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.382 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.399 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.165 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.927 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.692 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.708 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.471 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.488 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.574 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.391 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.477 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.293 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.379 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.467 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.553 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.639 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.727 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.814 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.631 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.447 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.264 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.081 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.166 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.224 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.635 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.643 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.654 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:46.409 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:47.345 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:48.096 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:49.032 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:49.969 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:50.725 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:51.660 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:52.417 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:53.171 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:54.108 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:55.091 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:55.847 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:56.829 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:58.488 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
0:59.677 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:00.865 single_asc U stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:02.055 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:03.243 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:04.431 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:05.619 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.965 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.975 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.035 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.447 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.505 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.917 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.977 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.389 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.449 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.509 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.921 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.332 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.372 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.756 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:23.794 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:24.832 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.217 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.630 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.640 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.986 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.332 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.679 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.689 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.035 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:36.355 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.677 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:38.715 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:40.098 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:41.481 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:42.472 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:43.793 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.803 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.150 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.496 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.507 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.856 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:51.177 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.170 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.208 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:54.593 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:55.631 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:57.016 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:58.055 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:58.812 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:00.195 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:01.578 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:01.578 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:02.615 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:03.999 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.058 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.470 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:07.454 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:08.438 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:09.421 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:10.173 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:11.157 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:12.092 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:13.030 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:13.968 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:14.904 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:15.658 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:16.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:17.168 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:17.922 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:18.674 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:19.862 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:21.051 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:22.241 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:23.486 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:25.147 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:26.776 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:27.815 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:29.199 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:30.237 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:31.620 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.681 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.739 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.152 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.564 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.624 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.683 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.181 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.590 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.003 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.415 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.474 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.887 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.271 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.312 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.350 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.734 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.118 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.178 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.236 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.295 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.707 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.718 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.063 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.072 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.081 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.092 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.437 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.781 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.803 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.213 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.213 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.626 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.008 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom ascendance, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.330 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.652 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:15.973 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:16.965 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.975 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.984 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:20.305 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:21.625 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.617 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:23.656 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.039 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.423 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.746 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.737 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.737 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:29.730 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:31.052 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:32.374 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:33.366 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:34.358 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:35.347 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:36.339 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:37.661 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:39.074 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:40.486 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:41.546 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.605 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:43.988 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:45.026 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:46.063 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:47.447 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.486 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:49.468 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:50.223 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:50.979 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:51.732 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:52.713 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:53.466 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:54.449 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:55.205 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:56.189 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:56.943 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:57.879 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:58.633 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:59.569 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:00.506 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:01.695 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:01.695 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:03.279 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:04.469 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:06.052 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:07.636 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:08.881 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.941 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:11.350 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.410 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.820 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.231 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.642 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.700 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.759 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.819 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:20.877 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:21.938 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:22.996 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:24.057 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:25.116 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:26.527 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:27.585 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:28.644 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:30.055 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.468 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.878 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.289 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.701 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.110 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.169 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.206 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.589 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.973 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.357 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.395 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.434 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:46.473 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:47.511 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.895 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.954 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.338 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.721 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.760 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:54.799 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:56.182 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.240 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.299 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.711 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81663 81663 44193
Intellect 58940 56709 46683 (20870)
Spirit 0 0 0
Health 4899780 4899780 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58940 56709 0
Crit 20.31% 20.31% 6125
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7245
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 955, weapon: { 4382 - 8141, 2.6 }, stats: { +1552 Int, +2329 Sta, +442 Crit, +424 Mastery, +19759 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 955, stats: { +2038 Int, +3057 Sta, +580 Crit, +557 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="1ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=955
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.75
# gear_stamina=44193
# gear_intellect=46683
# gear_crit_rating=6125
# gear_haste_rating=11779
# gear_mastery_rating=7245
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

2ilevel : 2107949 dps, 969268 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2107949.3 2107949.3 2527.6 / 0.120% 439669.1 / 20.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
2ilevel 2107949
Chain Lightning 200819 (437774) 9.6% (20.9%) 44.7 5.95sec 2948047 2360119 Direct 175.8 245217 677480 343627 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.69 175.83 0.00 0.00 1.2491 0.0000 60419713.26 60419713.26 0.00 2360119.29 2360119.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.80 77.24% 245217.33 148312 580624 245842.41 165132 306786 33302728 33302728 0.00
crit 40.03 22.76% 677479.93 410527 1607168 678388.76 455463 1013574 27116985 27116985 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 236955 11.3% 54.1 8.85sec 1318451 0 Direct 239.3 212507 585651 297958 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.09 239.34 0.00 0.00 0.0000 0.0000 71315065.36 71315065.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.53 77.10% 212507.05 124582 487724 212824.69 136602 318866 39213925 39213925 0.00
crit 54.81 22.90% 585650.57 344842 1350021 586646.93 371632 951948 32101140 32101140 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67446 3.2% 10.0 29.91sec 2019198 2120851 Direct 10.0 1428350 3946237 2019331 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9521 0.0000 20249888.39 20249888.39 0.00 2120851.32 2120851.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.68 76.53% 1428350.42 103045 1680871 1430322.09 0 1621137 10962765 10962765 0.00
crit 2.35 23.47% 3946237.36 313750 4652652 3625826.93 0 4652652 9287123 9287123 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (775322) 0.0% (36.8%) 50.5 5.54sec 4600850 4704565

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.54 0.00 0.00 0.00 0.9780 0.0000 0.00 0.00 0.00 4704564.59 4704564.59
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 573733 27.2% 299.8 0.93sec 573902 0 Direct 1538.3 80207 222080 111836 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.77 1538.28 0.00 0.00 0.0000 0.0000 172037083.07 172037083.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.34 77.71% 80206.72 69076 90142 80240.27 75906 84947 95874401 95874401 0.00
crit 342.95 22.29% 222080.42 191203 249513 222170.21 209794 235890 76162682 76162682 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 201589 9.6% 77.0 4.11sec 784962 0 Direct 77.0 562900 1557962 784958 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.03 77.03 0.00 0.00 0.0000 0.0000 60467203.54 60467203.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.84 77.68% 562899.78 540714 603088 563023.34 549047 585117 33684846 33684846 0.00
crit 17.19 22.32% 1557961.90 1496696 1669348 1558352.17 1501439 1637094 26782357 26782357 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57369 (87931) 2.7% (4.2%) 20.0 15.21sec 1317094 997016 Direct 20.0 612581 1693977 859366 22.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.3211 0.0000 17205068.63 17205068.63 0.00 997016.15 997016.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.45 77.18% 612581.37 525265 685453 612679.90 570441 653992 9464658 9464658 0.00
crit 4.57 22.82% 1693977.01 1453933 1897333 1683997.42 0 1897333 7740410 7740410 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30562 1.5% 12.7 22.90sec 723504 0 Direct 12.7 514230 1425437 723460 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.66 12.66 0.00 0.00 0.0000 0.0000 9163017.54 9163017.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.76 77.03% 514230.43 441223 575780 514314.90 447748 562038 5016863 5016863 0.00
crit 2.91 22.97% 1425436.54 1221304 1593760 1362355.11 0 1593760 4146154 4146154 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 87498 4.1% 26.5 11.35sec 990919 1029954 Direct 26.5 93239 258418 131460 23.1%  
Periodic 316.2 51081 141398 71903 23.1% 133.2%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.45 26.45 316.16 316.16 0.9621 1.2639 26210270.02 26210270.02 0.00 61667.60 1029954.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.33 76.86% 93239.26 78435 102355 93107.36 84278 98715 1895439 1895439 0.00
crit 6.12 23.14% 258418.05 217108 283318 257327.17 0 283318 1582003 1582003 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.3 76.95% 51081.43 37 56296 51053.91 46628 53454 12426697 12426697 0.00
crit 72.9 23.05% 141398.26 111 155828 141322.45 127692 149535 10306130 10306130 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 66090 (148829) 3.1% (7.0%) 7.6 28.42sec 5818838 4971730 Direct 36.4 385538 1068358 536603 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 36.39 0.00 0.00 1.1705 0.0000 19525329.39 19525329.39 0.00 4971729.65 4971729.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.33 77.87% 385537.56 176476 1011526 386542.47 226964 597359 10923923 10923923 0.00
crit 8.05 22.13% 1068357.88 488486 2799904 1064293.78 0 2445590 8601406 8601406 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82739 3.9% 11.2 39.51sec 2192352 0 Direct 54.9 319872 884991 445558 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 54.88 0.00 0.00 0.0000 0.0000 24454591.09 24454591.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.67 77.76% 319872.44 148239 849675 320694.98 188088 657565 13650700 13650700 0.00
crit 12.21 22.24% 884990.57 410325 2351901 886703.89 0 2258346 10803892 10803892 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 163013 (265400) 7.7% (12.6%) 57.6 5.15sec 1378077 1215172 Direct 57.6 259578 846540 846511 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.61 57.61 0.00 0.00 1.1341 0.0000 48763604.02 48763604.02 0.00 1215172.44 1215172.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 259578.40 228765 298530 737.72 0 298530 738 738 0.00
crit 57.60 100.00% 846539.83 697935 1173267 847109.13 800051 896310 48762866 48762866 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83762 4.0% 36.6 8.08sec 683689 0 Direct 36.6 220432 683709 683686 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.65 36.65 0.00 0.00 0.0000 0.0000 25056262.13 25056262.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 220432.21 192163 250765 398.66 0 250765 399 399 0.00
crit 36.65 100.00% 683709.21 563882 947917 684211.89 640395 742507 25055863 25055863 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18624 0.9% 42.9 6.35sec 129639 0 Direct 99.3 45120 92004 56031 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.93 99.32 0.00 0.00 0.0000 0.0000 5564918.82 5564918.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.20 76.73% 45120.26 43272 48263 45125.57 43373 47688 3438341 3438341 0.00
crit 23.11 23.27% 92004.05 88276 98457 92018.78 88276 98457 2126577 2126577 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49751 (96710) 2.4% (4.6%) 41.0 7.18sec 709839 584950 Direct 41.0 228649 634903 365165 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.98 40.98 0.00 0.00 1.2135 0.0000 14966934.40 14966934.40 0.00 584950.01 584950.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.21 66.39% 228648.95 155457 608597 229686.19 174325 373185 6221688 6221688 0.00
crit 13.77 33.61% 634903.17 430304 1684596 636329.94 457870 1405348 8745247 8745247 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46959 2.2% 45.9 8.53sec 307653 0 Direct 45.9 192655 536832 307650 33.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.91 45.91 0.00 0.00 0.0000 0.0000 14125554.49 14125554.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.57 66.59% 192654.65 130584 511221 193098.17 146569 339038 5889748 5889748 0.00
crit 15.34 33.41% 536832.15 361456 1415060 537849.56 374816 1159974 8235807 8235807 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (60031) 0.0% (2.8%) 3.0 120.32sec 5985197 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.91 0.00 0.0000 1.0000 0.00 0.00 0.00 308645.05 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19352 0.9% 38.1 6.90sec 151225 0 Direct 38.1 121869 248614 151227 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.10 38.10 0.00 0.00 0.0000 0.0000 5760959.43 5760959.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.27 76.84% 121869.49 121869 121869 121869.49 121869 121869 3567371 3567371 0.00
crit 8.82 23.16% 248613.77 248614 248614 248581.65 0 248614 2193589 2193589 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40679 1.9% 99.0 2.62sec 122332 0 Direct 99.0 98655 201256 122332 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.01 99.01 0.00 0.00 0.0000 0.0000 12112675.21 12112675.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.16 76.92% 98654.92 98655 98655 98654.92 98655 98655 7514049 7514049 0.00
crit 22.85 23.08% 201256.04 201256 201256 201256.04 201256 201256 4598626 4598626 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 144353 / 55711
Fire Blast 144353 2.6% 63.1 4.28sec 262995 146985 Direct 63.1 213819 427657 262992 23.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.12 63.12 0.00 0.00 1.7893 0.0000 16600218.60 16600218.60 0.00 146985.24 146985.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.60 77.00% 213819.34 200540 223673 213821.02 209088 221300 10392657 10392657 0.00
crit 14.52 23.00% 427656.76 401079 447346 427668.48 415908 447346 6207561 6207561 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186494 / 25298
Lightning Blast 186494 1.2% 40.0 7.04sec 189679 202417 Direct 40.0 154874 309858 189672 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.01 40.01 0.00 0.00 0.9371 0.0000 7589424.54 7589424.54 0.00 202417.04 202417.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.03 77.54% 154873.77 148548 165684 154927.05 149989 163047 4805305 4805305 0.00
crit 8.99 22.46% 309857.70 297096 331367 309896.17 0 331367 2784120 2784120 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
2ilevel
Ascendance 2.0 181.48sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0335 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.31sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8123 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.62sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5094 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.6sec 181.6sec 10.14% 15.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 24.9sec 32.13% 32.13% 3.1(3.1) 8.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.3sec 69.3sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.5sec 25.6sec 31.73% 31.73% 1.3(1.3) 9.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.5sec 31.61% 31.61% 1.3(1.3) 9.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.7sec 25.7sec 30.47% 30.47% 1.6(1.6) 8.9

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.4 28.7 3.8sec 2.8sec 73.64% 68.20% 28.7(28.7) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.91%
  • elemental_focus_2:52.74%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.3 7.1 11.9sec 9.1sec 25.57% 42.79% 7.2(7.2) 1.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.57%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 29.88% 29.88% 4.3(4.3) 12.6

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.5sec 85.5sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.42%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.5sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 46.1sec 31.8sec 31.23% 38.35% 2.4(5.9) 2.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.82%
  • power_of_the_maelstrom_2:7.09%
  • power_of_the_maelstrom_3:18.33%

Trigger Attempt Success

  • trigger_pct:14.95%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.1sec 44.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.08%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.2sec 11.32% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.60%
  • stormkeeper_3:3.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.5 9.1sec
Lava Surge: Wasted 7.3 30.6sec
Lava Surge: During Lava Burst 4.3 53.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6390.00116.64816.0240.00019.636
Fire Elemental0.3300.0011.2490.0920.0001.249
Ascendance1.8270.0019.2611.6250.0009.261
Lava Burst2.9160.00138.06444.2849.654105.652
Elemental Blast2.1260.00119.52235.61317.88462.287

Resources

Resource Usage Type Count Total Average RPE APR
2ilevel
earth_shock Maelstrom 75.4 8937.6 118.6 891.2 2265.7
earthquake Maelstrom 379.8 18991.4 50.0 375.8 12242.6
flame_shock Maelstrom 198.8 3762.2 18.9 142.2 6966.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 432.97 5140.40 (16.04%) 11.87 55.23 1.06%
Lava Burst Overload Maelstrom 275.46 2413.91 (7.53%) 8.76 65.24 2.63%
Lava Beam Maelstrom 56.81 1599.38 (4.99%) 28.15 41.50 2.53%
Lava Beam Overload Maelstrom 83.84 1576.80 (4.92%) 18.81 73.21 4.44%
Chain Lightning Maelstrom 335.87 7787.76 (24.30%) 23.19 141.64 1.79%
Chain Lightning Overload Maelstrom 406.54 6805.91 (21.24%) 16.74 389.67 5.42%
Lightning Bolt Maelstrom 308.04 2455.21 (7.66%) 7.97 9.10 0.37%
Lightning Bolt Overload Maelstrom 345.08 2050.07 (6.40%) 5.94 20.39 0.98%
Resonance Totem Maelstrom 2244.52 2216.23 (6.92%) 0.99 28.29 1.26%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.24 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 2ilevel Fight Length
Count 7741
Mean 300.01
Minimum 239.96
Maximum 360.05
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.9831
5th Percentile 245.62
95th Percentile 354.37
( 95th Percentile - 5th Percentile ) 108.75
Mean Distribution
Standard Deviation 0.3976
95.00% Confidence Intervall ( 299.23 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 523
0.1% Error 52235
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1045
DPS
Sample Data 2ilevel Damage Per Second
Count 7741
Mean 2107949.26
Minimum 1730358.00
Maximum 2596779.44
Spread ( max - min ) 866421.44
Range [ ( max - min ) / 2 * 100% ] 20.55%
Standard Deviation 113466.0926
5th Percentile 1931932.27
95th Percentile 2301444.59
( 95th Percentile - 5th Percentile ) 369512.32
Mean Distribution
Standard Deviation 1289.6372
95.00% Confidence Intervall ( 2105421.61 - 2110476.90 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11131
0.1 Scale Factor Error with Delta=300 109904600
0.05 Scale Factor Error with Delta=300 439618398
0.01 Scale Factor Error with Delta=300 10990459941
Priority Target DPS
Sample Data 2ilevel Priority Target Damage Per Second
Count 7741
Mean 969268.22
Minimum 824560.23
Maximum 1146758.31
Spread ( max - min ) 322198.07
Range [ ( max - min ) / 2 * 100% ] 16.62%
Standard Deviation 41665.9707
5th Percentile 904540.51
95th Percentile 1040278.93
( 95th Percentile - 5th Percentile ) 135738.42
Mean Distribution
Standard Deviation 473.5687
95.00% Confidence Intervall ( 968340.04 - 970196.39 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7099
0.1 Scale Factor Error with Delta=300 14819948
0.05 Scale Factor Error with Delta=300 59279792
0.01 Scale Factor Error with Delta=300 1481994792
DPS(e)
Sample Data 2ilevel Damage Per Second (Effective)
Count 7741
Mean 2107949.26
Minimum 1730358.00
Maximum 2596779.44
Spread ( max - min ) 866421.44
Range [ ( max - min ) / 2 * 100% ] 20.55%
Damage
Sample Data 2ilevel Damage
Count 7741
Mean 607398138.77
Minimum 404610840.25
Maximum 835505799.75
Spread ( max - min ) 430894959.50
Range [ ( max - min ) / 2 * 100% ] 35.47%
DTPS
Sample Data 2ilevel Damage Taken Per Second
Count 7741
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 2ilevel Healing Per Second
Count 7741
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 2ilevel Healing Per Second (Effective)
Count 7741
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 2ilevel Heal
Count 7741
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 2ilevel Healing Taken Per Second
Count 7741
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 2ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 2ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 2ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.01 totem_mastery,if=buff.resonance_totem.remains<2
9 2.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.99 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.93 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.03 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 50.54 earthquake
J 1.67 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.70 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.56 lava_beam
M 36.41 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.85 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.12 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.80 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.43 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.85 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.03 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 56.11 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.26 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.79 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.95 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.30 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.39 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWVRVVWPWWWTWWWWWSILILIILMIWWXSXbbddWTbWXXbbSWdIMIMIMIIMJIKMMFMIMMIMIMMSdQWMIIIMIIMJIKMWccWXXXccccSWTcWIMIMIIMSWW8WWAXXbbWTSWbQdFHMIMIMIIMSWWddddTdWdXWSXddcWIMIMIIIMSWRWXXWWWdPWSWTWWLFILIIMISVWWXXW97bbdTWWXbSbbWIIMMIIMMIS8WWXAXXWWbbWTWSbbWbdIIMFIMIMSWWVTWWbXXXbSWWWWIIMMIMIMIMIMSWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:02.627 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.381 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.138 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.892 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.646 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.400 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.154 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:07.154 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:07.910 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:08.668 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:09.424 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:10.178 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:10.935 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:11.691 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:12.447 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.204 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:14.456 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:15.866 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:16.807 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:18.061 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:19.002 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:20.256 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:21.196 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.011 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, ascendance, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.097 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.184 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.000 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.085 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.171 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.971 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.037 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.837 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.904 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.970 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.035 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.100 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.189 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.007 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.094 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.910 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.727 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.544 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.630 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.714 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.125 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.537 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.883 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.891 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.239 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.250 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.597 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.607 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.953 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.962 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:54.716 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:55.698 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:56.450 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:57.205 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:58.186 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
0:59.170 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:00.152 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:00.907 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:01.660 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:02.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:03.168 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:03.924 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:04.678 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:05.659 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:06.907 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:08.568 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:10.228 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:11.888 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:13.546 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:14.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.203 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.614 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.673 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.732 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.792 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.202 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.262 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.321 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.733 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.771 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.811 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.194 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.577 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.898 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.218 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:34.137 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:35.055 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:35.811 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:36.566 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:37.322 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:38.258 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:39.194 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:40.130 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:41.111 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:42.172 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:43.154 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:43.908 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:44.891 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:45.645 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:46.866 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:48.493 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:49.715 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:51.340 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:52.561 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:53.784 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:55.167 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:56.551 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:57.588 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:58.579 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:59.333 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:00.679 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:01.691 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:01.691 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.702 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:03.713 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.060 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.405 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.415 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.477 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.958 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.369 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.780 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:13.838 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:15.247 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.306 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.364 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.423 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.482 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.540 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.599 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.658 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.718 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.777 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.189 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.600 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.660 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.071 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:31.485 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:32.869 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:33.832 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:34.793 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:35.548 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:36.511 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:37.476 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:38.438 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.192 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.945 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.925 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.680 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:42.617 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:43.554 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:44.492 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:45.428 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:46.616 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:48.200 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:49.388 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:50.974 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:52.163 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:53.410 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.469 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.879 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.291 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.637 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.647 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.995 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.005 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.014 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.025 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.370 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.382 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.727 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.727 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.137 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.697 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.109 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.148 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.533 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.916 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.299 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.338 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.398 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.811 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.871 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.930 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.990 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.049 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.463 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:27.219 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:28.154 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:29.089 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:29.844 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:30.597 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:31.352 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:32.107 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:32.107 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:33.043 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:33.979 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:34.915 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:35.671 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:36.426 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:37.361 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:38.116 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:39.098 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:40.758 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:42.341 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:43.924 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:45.093 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:46.260 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:47.427 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.747 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:50.067 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:51.077 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:52.088 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:53.500 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:54.910 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:55.969 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:57.378 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:58.134 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:59.194 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:00.606 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.666 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.666 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.725 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:03.765 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:04.802 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:05.557 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:06.520 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:07.483 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:08.237 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:08.992 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:09.953 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:10.935 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:11.918 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:12.900 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:13.655 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:14.637 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:15.620 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:16.375 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:17.620 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:19.281 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:20.526 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:21.772 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:23.017 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:24.264 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.326 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.739 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:28.060 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:29.380 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:30.372 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:31.363 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:32.354 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.675 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.023 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.034 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.045 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.085 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.467 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.850 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.888 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.880 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:43.871 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:45.192 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:45.947 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:46.702 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:47.621 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:48.539 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:49.294 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:50.229 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:50.985 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:51.921 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:52.677 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:53.658 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:54.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:55.395 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:56.377 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:57.131 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:58.791 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81741 81741 44242
Intellect 59165 56934 46898 (20870)
Spirit 0 0 0
Health 4904460 4904460 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59165 56934 0
Crit 20.32% 20.32% 6128
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.77% 58.77% 7249
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 956, weapon: { 4423 - 8216, 2.6 }, stats: { +1567 Int, +2350 Sta, +443 Crit, +426 Mastery, +19940 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 956, stats: { +2057 Int, +3085 Sta, +582 Crit, +559 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="2ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=956
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.88
# gear_stamina=44242
# gear_intellect=46898
# gear_crit_rating=6128
# gear_haste_rating=11779
# gear_mastery_rating=7249
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

3ilevel : 2118152 dps, 973768 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2118151.5 2118151.5 2539.2 / 0.120% 451853.5 / 21.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
3ilevel 2118152
Chain Lightning 201830 (440099) 9.6% (20.9%) 44.6 6.02sec 2969300 2378179 Direct 175.8 246363 680445 345393 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.59 175.81 0.00 0.00 1.2486 0.0000 60723994.70 60723994.70 0.00 2378179.13 2378179.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.71 77.19% 246362.77 148913 582736 246808.06 167341 309284 33434004 33434004 0.00
crit 40.11 22.81% 680444.92 412192 1613013 681371.96 458874 991962 27289991 27289991 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 238270 11.3% 54.0 9.00sec 1326382 0 Direct 239.4 213182 588613 299437 23.0%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.04 239.37 0.00 0.00 0.0000 0.0000 71676371.83 71676371.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.38 77.03% 213181.87 125087 489498 213465.32 138438 316352 39306988 39306988 0.00
crit 54.99 22.97% 588613.05 346241 1354931 589497.23 379534 947650 32369384 32369384 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67927 3.2% 10.0 29.91sec 2029560 2132043 Direct 10.0 1433110 3965165 2029598 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.05 10.05 0.00 0.00 0.9520 0.0000 20392989.84 20392989.84 0.00 2132042.85 2132042.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.68 76.44% 1433110.43 103463 1686985 1435263.78 985797 1651379 11007634 11007634 0.00
crit 2.37 23.56% 3965164.54 306632 4669573 3642943.06 0 4669573 9385356 9385356 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (778789) 0.0% (36.8%) 50.5 5.55sec 4618511 4724206

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.54 0.00 0.00 0.00 0.9776 0.0000 0.00 0.00 0.00 4724205.92 4724205.92
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 576411 27.2% 299.8 0.93sec 576318 0 Direct 1538.3 80552 223011 112313 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.78 1538.25 0.00 0.00 0.0000 0.0000 172765830.77 172765830.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.29 77.70% 80551.63 69356 90470 80584.60 76707 85120 96282727 96282727 0.00
crit 342.96 22.30% 223010.60 191979 250420 223095.98 212247 235626 76483104 76483104 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 202378 9.6% 77.0 4.17sec 787978 0 Direct 77.0 565188 1564354 787984 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.96 76.96 0.00 0.00 0.0000 0.0000 60643011.36 60643011.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.80 77.70% 565187.89 542907 605282 565316.89 548928 587962 33798180 33798180 0.00
crit 17.16 22.30% 1564354.15 1502767 1675419 1564708.05 1509408 1648858 26844832 26844832 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57752 (88424) 2.7% (4.2%) 20.0 15.18sec 1323781 1002362 Direct 20.0 614809 1701829 864692 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.3207 0.0000 17322003.54 17322003.54 0.00 1002362.39 1002362.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 77.01% 614809.41 527396 687946 614917.15 565959 653243 9485587 9485587 0.00
crit 4.60 22.99% 1701829.27 1459831 1904234 1691473.79 0 1904234 7836417 7836417 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30672 1.4% 12.7 22.96sec 725986 0 Direct 12.7 516371 1429485 726013 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.67 12.67 0.00 0.00 0.0000 0.0000 9197498.18 9197498.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.76 77.04% 516370.64 443012 577874 516432.94 461990 566423 5040139 5040139 0.00
crit 2.91 22.96% 1429484.81 1226258 1599556 1364725.07 0 1599556 4157359 4157359 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 87949 4.2% 26.5 11.28sec 994790 1034107 Direct 26.5 93587 259443 132421 23.4%  
Periodic 316.4 51284 141960 72195 23.1% 133.2%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.48 26.48 316.36 316.36 0.9620 1.2633 26346979.61 26346979.61 0.00 61973.35 1034107.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.28 76.58% 93586.68 78753 102727 93452.80 83605 99144 1898257 1898257 0.00
crit 6.20 23.42% 259443.22 217988 284348 258221.65 0 284348 1608979 1608979 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.4 76.94% 51283.69 36 56501 51253.62 46724 53468 12482571 12482571 0.00
crit 73.0 23.06% 141960.48 272 156394 141865.57 128129 149170 10357173 10357173 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 66333 (149363) 3.1% (7.0%) 7.6 28.49sec 5843802 4993719 Direct 36.4 386536 1072616 538709 22.2%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 36.38 0.00 0.00 1.1703 0.0000 19598873.53 19598873.53 0.00 4993718.65 4993718.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 77.82% 386536.40 177192 1015205 387609.64 233293 655556 10942812 10942812 0.00
crit 8.07 22.18% 1072615.59 490468 2810087 1070620.85 0 2401784 8656062 8656062 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 83030 3.9% 11.2 39.98sec 2192990 0 Direct 55.0 320635 882631 445579 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 55.05 0.00 0.00 0.0000 0.0000 24530618.17 24530618.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.81 77.76% 320634.53 148840 852766 321045.72 180642 676161 13726427 13726427 0.00
crit 12.24 22.24% 882630.95 411989 2360455 884661.11 0 2117210 10804191 10804191 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 163924 (266719) 7.7% (12.6%) 57.7 5.14sec 1382391 1219618 Direct 57.7 265077 849657 849632 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.71 57.71 0.00 0.00 1.1335 0.0000 49031643.38 49031643.38 0.00 1219618.41 1219618.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 265076.62 229693 287741 644.46 0 287741 644 644 0.00
crit 57.71 100.00% 849656.75 700766 1177648 850226.10 807414 907192 49030999 49030999 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 84105 4.0% 36.7 8.04sec 686217 0 Direct 36.7 227369 686233 686218 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.66 36.66 0.00 0.00 0.0000 0.0000 25154258.09 25154258.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 227369.32 215109 241702 261.85 0 241702 262 262 0.00
crit 36.66 100.00% 686232.79 566169 951457 686682.13 640233 740124 25153996 25153996 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18691 0.9% 43.1 6.42sec 129841 0 Direct 99.6 45281 92315 56156 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.06 99.55 0.00 0.00 0.0000 0.0000 5590558.14 5590558.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.54 76.88% 45280.82 43448 48439 45284.43 43600 47940 3465606 3465606 0.00
crit 23.02 23.12% 92315.50 88634 98815 92341.63 88634 98554 2124952 2124952 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 50067 (97401) 2.4% (4.6%) 41.0 7.14sec 714420 588587 Direct 41.0 229707 638988 367289 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.2138 0.0000 15058776.89 15058776.89 0.00 588587.48 588587.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.22 66.39% 229707.23 156087 610810 230783.99 175417 382996 6253230 6253230 0.00
crit 13.78 33.61% 638987.65 432050 1690722 640817.61 0 1357781 8805547 8805547 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 47334 2.2% 46.0 8.53sec 309478 0 Direct 46.0 193920 538026 309480 33.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.00 46.00 0.00 0.00 0.0000 0.0000 14234633.59 14234633.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.55 66.42% 193920.38 131113 513080 194330.24 146701 357683 5923925 5923925 0.00
crit 15.45 33.58% 538026.04 362922 1420207 539113.44 393060 1047560 8310709 8310709 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (60039) 0.0% (2.8%) 3.0 120.32sec 5987675 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.93 0.00 0.0000 1.0000 0.00 0.00 0.00 308521.08 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19340 0.9% 38.0 6.90sec 151326 0 Direct 38.0 121869 248614 151328 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.03 38.03 0.00 0.00 0.0000 0.0000 5754496.92 5754496.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.19 76.76% 121869.49 121869 121869 121869.49 121869 121869 3557279 3557279 0.00
crit 8.84 23.24% 248613.77 248614 248614 248613.77 248614 248614 2197218 2197218 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40699 1.9% 99.1 2.61sec 122310 0 Direct 99.1 98655 201256 122309 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.06 99.06 0.00 0.00 0.0000 0.0000 12116586.71 12116586.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.23 76.94% 98654.92 98655 98655 98654.92 98655 98655 7520017 7520017 0.00
crit 22.84 23.06% 201256.04 201256 201256 201256.04 201256 201256 4596570 4596570 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 144904 / 55963
Fire Blast 144904 2.6% 63.2 4.27sec 263912 147544 Direct 63.2 214632 429236 263915 23.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.16 63.16 0.00 0.00 1.7887 0.0000 16668884.92 16668884.92 0.00 147543.59 147543.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 77.04% 214632.09 201353 224486 214631.21 209806 221839 10443501 10443501 0.00
crit 14.50 22.96% 429235.67 402706 448973 429243.62 417959 446782 6225384 6225384 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 187570 / 25479
Lightning Blast 187570 1.2% 40.1 7.04sec 190643 203526 Direct 40.1 155455 310962 190642 22.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.09 40.09 0.00 0.00 0.9367 0.0000 7643221.76 7643221.76 0.00 203526.17 203526.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.02 77.37% 155454.64 149150 166286 155498.49 150523 162912 4822120 4822120 0.00
crit 9.07 22.63% 310962.18 298301 332572 311008.92 0 332572 2821102 2821102 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
3ilevel
Ascendance 2.0 181.74sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0326 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.07sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 0.00 0.00 0.8135 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.61sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5095 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.6sec 181.6sec 10.14% 15.77% 0.0(0.0) 2.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.07% 32.07% 3.1(3.1) 8.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.1sec 69.1sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.6sec 25.6sec 31.62% 31.62% 1.3(1.3) 9.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.6sec 31.66% 31.66% 1.3(1.3) 9.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.6sec 30.56% 30.56% 1.6(1.6) 8.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.6 28.8 3.8sec 2.8sec 73.78% 68.33% 28.8(28.8) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.95%
  • elemental_focus_2:52.82%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.5 7.1 11.8sec 9.1sec 25.58% 42.86% 7.2(7.2) 1.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.58%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.79% 29.79% 4.2(4.2) 12.6

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.6sec 85.6sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.28%
Nefarious Pact 3.5 0.0 69.5sec 69.5sec 13.55% 13.55% 0.0(0.0) 3.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.55%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.4sec 0.0sec 39.82% 39.82% 0.0(0.0) 1.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 45.6sec 31.5sec 31.53% 38.54% 2.4(6.0) 2.1

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.91%
  • power_of_the_maelstrom_2:7.22%
  • power_of_the_maelstrom_3:18.41%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.5sec 44.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.03%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.30% 9.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.59%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.7 9.1sec
Lava Surge: Wasted 7.2 30.6sec
Lava Surge: During Lava Burst 4.4 53.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6040.00116.65315.9580.13220.421
Fire Elemental0.3300.0011.2490.0950.0001.249
Ascendance1.8570.0019.3671.6400.0009.367
Lava Burst2.9060.00134.87644.31710.97595.977
Elemental Blast2.1190.00118.06935.53419.13760.281

Resources

Resource Usage Type Count Total Average RPE APR
3ilevel
earth_shock Maelstrom 73.5 8711.6 118.6 867.0 2340.9
earthquake Maelstrom 369.5 18474.1 50.0 365.6 12634.4
flame_shock Maelstrom 193.6 3664.8 18.9 138.4 7189.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 421.91 5008.88 (16.06%) 11.87 54.05 1.07%
Lava Burst Overload Maelstrom 267.99 2348.30 (7.53%) 8.76 63.57 2.64%
Lava Beam Maelstrom 55.21 1553.77 (4.98%) 28.14 41.93 2.63%
Lava Beam Overload Maelstrom 81.80 1538.01 (4.93%) 18.80 72.07 4.48%
Chain Lightning Maelstrom 326.00 7575.88 (24.29%) 23.24 136.68 1.77%
Chain Lightning Overload Maelstrom 395.07 6621.16 (21.23%) 16.76 379.12 5.42%
Lightning Bolt Maelstrom 299.80 2389.77 (7.66%) 7.97 8.65 0.36%
Lightning Bolt Overload Maelstrom 336.31 1997.67 (6.41%) 5.94 20.19 1.00%
Resonance Totem Maelstrom 2183.20 2155.51 (6.91%) 0.99 27.69 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.22 14.07
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.35 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 3ilevel Fight Length
Count 7815
Mean 299.99
Minimum 239.96
Maximum 360.05
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.1929
5th Percentile 245.68
95th Percentile 354.28
( 95th Percentile - 5th Percentile ) 108.60
Mean Distribution
Standard Deviation 0.3981
95.00% Confidence Intervall ( 299.21 - 300.77 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 529
0.1% Error 52869
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1058
DPS
Sample Data 3ilevel Damage Per Second
Count 7815
Mean 2118151.50
Minimum 1745857.73
Maximum 2630803.50
Spread ( max - min ) 884945.77
Range [ ( max - min ) / 2 * 100% ] 20.89%
Standard Deviation 114527.8936
5th Percentile 1938156.96
95th Percentile 2313117.92
( 95th Percentile - 5th Percentile ) 374960.96
Mean Distribution
Standard Deviation 1295.5279
95.00% Confidence Intervall ( 2115612.31 - 2120690.69 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11231
0.1 Scale Factor Error with Delta=300 111971170
0.05 Scale Factor Error with Delta=300 447884680
0.01 Scale Factor Error with Delta=300 11197116977
Priority Target DPS
Sample Data 3ilevel Priority Target Damage Per Second
Count 7815
Mean 973767.52
Minimum 827350.92
Maximum 1153939.73
Spread ( max - min ) 326588.81
Range [ ( max - min ) / 2 * 100% ] 16.77%
Standard Deviation 42196.5654
5th Percentile 906142.77
95th Percentile 1044874.82
( 95th Percentile - 5th Percentile ) 138732.05
Mean Distribution
Standard Deviation 477.3233
95.00% Confidence Intervall ( 972831.99 - 974703.06 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7214
0.1 Scale Factor Error with Delta=300 15199801
0.05 Scale Factor Error with Delta=300 60799201
0.01 Scale Factor Error with Delta=300 1519980003
DPS(e)
Sample Data 3ilevel Damage Per Second (Effective)
Count 7815
Mean 2118151.50
Minimum 1745857.73
Maximum 2630803.50
Spread ( max - min ) 884945.77
Range [ ( max - min ) / 2 * 100% ] 20.89%
Damage
Sample Data 3ilevel Damage
Count 7815
Mean 610139125.27
Minimum 424242042.89
Maximum 859840245.13
Spread ( max - min ) 435598202.24
Range [ ( max - min ) / 2 * 100% ] 35.70%
DTPS
Sample Data 3ilevel Damage Taken Per Second
Count 7815
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 3ilevel Healing Per Second
Count 7815
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 3ilevel Healing Per Second (Effective)
Count 7815
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 3ilevel Heal
Count 7815
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 3ilevel Healing Taken Per Second
Count 7815
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 3ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 3ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 3ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.03 totem_mastery,if=buff.resonance_totem.remains<2
9 2.02 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.01 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.97 stormkeeper
G 0.17 ascendance
0.00 liquid_magma_totem
H 2.10 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 51.02 earthquake
J 1.71 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.73 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.62 lava_beam
M 36.78 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.85 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.16 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.81 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.61 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.94 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.08 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 56.73 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.42 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.81 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.59 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.90 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.45 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.39 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRWdddPWWTWWWSILLIIILLIIWWXSbbbddTWddddWSQWIIMMIIMIISWWbTbWbWbbSTbQWFMIMIMIMISWWbbTeWXbWXSWWWXcWcIIIMIMMISW8WXAQXddWWWSTddMFIIMIMIMMSWWdQdfddWdSdWXXddIMIMIIIMIMRSWWXXccIIGJWSWWILFILILISWVWTQb97WWXSXbbWWIIMMIMIMQ8SWWAXXddWbWTSbbMIMIFMIIMIIQSWWXddWdddWTSddXdMIMIMIMIIMMQSW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.051 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.087 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.865 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.643 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.420 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.200 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.978 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.978 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.014 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.050 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.828 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.864 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.899 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.987 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.074 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.891 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.979 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.064 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.881 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.698 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.514 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.600 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.686 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.503 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.320 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.404 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.491 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.308 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.395 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.483 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.569 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.656 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.742 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.828 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.642 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.707 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.772 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.839 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.904 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.969 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.768 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.180 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.191 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.538 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.548 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.558 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.906 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.253 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.263 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.274 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.623 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.682 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.720 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.103 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.095 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.416 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.737 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.748 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.095 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.105 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.452 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.800 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.148 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.560 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.972 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.032 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.444 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.504 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.564 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.624 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.683 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:18.721 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:19.759 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:20.798 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.837 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.877 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.288 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.348 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.760 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.106 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.453 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.800 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:32.147 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.159 single_asc e flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom movement, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:34.170 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:35.161 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:35.917 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:36.834 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:37.797 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:38.551 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:39.718 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:40.473 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:41.410 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:42.165 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:42.918 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:43.857 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:44.612 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:45.549 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:46.304 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:47.472 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:48.638 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:50.191 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:51.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:53.042 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:54.704 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.763 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.176 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.235 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.988 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.399 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:01.459 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:01.459 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.519 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:03.580 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.990 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:06.401 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:07.461 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:08.875 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:09.935 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:11.346 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:12.355 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:13.701 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:15.049 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.395 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.630 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.639 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.650 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.660 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.671 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.730 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:23.768 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:24.807 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:26.191 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:27.576 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:28.897 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.215 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.535 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.529 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.519 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom movement, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.511 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.857 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.203 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.550 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.532 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.552 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.534 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:42.288 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:43.041 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:43.795 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:44.777 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:45.762 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:46.516 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:47.500 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:48.254 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:49.238 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:49.993 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:50.748 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:51.995 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:53.656 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:54.904 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:56.565 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:57.786 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:59.413 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.797 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.180 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.218 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.278 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.688 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.099 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.160 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.220 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.220 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.256 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.640 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.026 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.409 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.794 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.854 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.266 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.324 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.382 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.794 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.855 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.267 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.328 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.738 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.798 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.856 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.269 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.329 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.390 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.803 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.060 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.060 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:36.118 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:37.530 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:38.588 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:40.144 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:41.153 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.500 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.846 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:44.857 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:45.865 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.876 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:47.867 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:49.188 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:50.508 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:51.548 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:52.932 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:53.972 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:55.355 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:56.394 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:57.148 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:58.532 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:59.915 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.298 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.298 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.336 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.375 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.759 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:06.169 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.229 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.641 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.051 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.109 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:12.520 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:13.866 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:15.213 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:16.561 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:17.571 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:18.917 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.928 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.939 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:21.950 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:22.704 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:23.460 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:24.216 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:24.972 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:25.724 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:26.478 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:27.440 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:28.422 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:29.404 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:30.159 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:30.914 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:31.898 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:32.653 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:33.636 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:35.296 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:36.956 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:38.616 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:39.862 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:41.523 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:42.505 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:43.489 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:44.243 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:45.226 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.210 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.962 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:47.945 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:48.699 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:49.682 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:50.438 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:51.421 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.175 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.930 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:53.912 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:55.575 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:56.823 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:58.484 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81824 81824 44295
Intellect 59405 57174 47126 (20870)
Spirit 0 0 0
Health 4909440 4909440 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59405 57174 0
Crit 20.33% 20.33% 6133
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.79% 58.79% 7253
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 957, weapon: { 4465 - 8293, 2.6 }, stats: { +1582 Int, +2373 Sta, +445 Crit, +428 Mastery, +20134 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 957, stats: { +2076 Int, +3115 Sta, +585 Crit, +561 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="3ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=957
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=934.00
# gear_stamina=44295
# gear_intellect=47126
# gear_crit_rating=6133
# gear_haste_rating=11779
# gear_mastery_rating=7253
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

baseline : 2091941 dps, 962681 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2091941.0 2091941.0 2508.4 / 0.120% 434179.3 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 2091941
Chain Lightning 199710 (435017) 9.6% (20.9%) 44.6 6.03sec 2930654 2347240 Direct 175.9 243699 673784 341709 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.65 175.87 0.00 0.00 1.2486 0.0000 60093531.42 60093531.42 0.00 2347239.53 2347239.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.79 77.21% 243699.36 147181 576656 244248.20 164084 317144 33092165 33092165 0.00
crit 40.07 22.79% 673784.26 407397 1596184 674830.47 448416 1048591 27001366 27001366 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 235307 11.3% 53.9 9.01sec 1311804 0 Direct 239.1 210885 581910 295934 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.93 239.05 0.00 0.00 0.0000 0.0000 70748641.77 70748641.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.26 77.08% 210885.35 123632 484391 211261.14 136824 307003 38860383 38860383 0.00
crit 54.80 22.92% 581910.41 342214 1340795 583321.65 372729 916833 31888259 31888259 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67056 3.2% 10.0 30.05sec 2009364 2111431 Direct 10.0 1417118 3924713 2009169 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.02 10.02 0.00 0.00 0.9517 0.0000 20126160.06 20126160.06 0.00 2111430.98 2111430.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.65 76.38% 1417117.69 119643 1669384 1419852.32 994830 1656029 10841600 10841600 0.00
crit 2.37 23.62% 3924713.01 331172 4620854 3617678.79 0 4620854 9284560 9284560 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (768384) 0.0% (36.8%) 50.5 5.56sec 4558977 4663137

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.52 0.00 0.00 0.00 0.9777 0.0000 0.00 0.00 0.00 4663136.89 4663136.89
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 569011 27.2% 299.7 0.93sec 569083 0 Direct 1536.5 79650 220500 111008 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.72 1536.50 0.00 0.00 0.0000 0.0000 170565046.88 170565046.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1194.42 77.74% 79650.15 68550 89526 79681.78 75145 83691 95135722 95135722 0.00
crit 342.08 22.26% 220499.50 189746 247808 220587.80 208255 232454 75429325 75429325 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199373 9.5% 76.7 4.17sec 779393 0 Direct 76.7 558892 1546828 779376 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.67 76.67 0.00 0.00 0.0000 0.0000 59756610.21 59756610.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.56 77.68% 558892.28 536592 598966 559029.69 544056 585797 33286818 33286818 0.00
crit 17.11 22.32% 1546828.12 1485287 1657939 1547275.03 1485287 1624073 26469792 26469792 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57244 (87540) 2.7% (4.2%) 20.0 15.21sec 1310387 992577 Direct 20.0 607884 1682452 856724 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.3202 0.0000 17159740.96 17159740.96 0.00 992576.75 992576.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.39 76.85% 607884.07 521261 680768 607940.49 557926 651023 9357083 9357083 0.00
crit 4.64 23.15% 1682451.86 1442850 1884366 1671425.69 0 1884366 7802658 7802658 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30296 1.5% 12.7 23.14sec 718198 0 Direct 12.7 510783 1412677 718224 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.65 12.65 0.00 0.00 0.0000 0.0000 9087958.51 9087958.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.74 77.00% 510783.26 437859 571845 510802.90 451954 556958 4976975 4976975 0.00
crit 2.91 23.00% 1412676.80 1211994 1582868 1345932.63 0 1582868 4110984 4110984 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86812 4.2% 26.5 11.27sec 981929 1020816 Direct 26.5 92528 256545 130634 23.2%  
Periodic 316.1 50690 140367 71319 23.0% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.49 26.49 316.14 316.14 0.9619 1.2633 26007322.27 26007322.27 0.00 61213.00 1020815.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.33 76.77% 92528.27 77837 101655 92388.37 83346 97312 1881324 1881324 0.00
crit 6.15 23.23% 256544.80 215453 281381 255182.70 0 281381 1578651 1578651 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.4 77.00% 50690.43 32 55911 50657.23 46294 52844 12338812 12338812 0.00
crit 72.7 23.00% 140367.48 207 154763 140274.40 128428 147860 10208536 10208536 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65469 (147321) 3.1% (6.9%) 7.6 28.42sec 5754615 4920436 Direct 36.5 381165 1053115 530546 22.2%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.57 36.46 0.00 0.00 1.1696 0.0000 19344920.88 19344920.88 0.00 4920436.15 4920436.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.36 77.77% 381164.95 175131 1004613 382090.48 226830 585576 10808581 10808581 0.00
crit 8.11 22.23% 1053114.55 484763 2780769 1048910.33 0 2239634 8536340 8536340 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 81852 3.9% 11.2 39.84sec 2166601 0 Direct 54.9 316405 873459 440482 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 54.92 0.00 0.00 0.0000 0.0000 24191098.17 24191098.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.69 77.73% 316405.19 147109 843868 316665.07 0 702760 13507602 13507602 0.00
crit 12.23 22.27% 873459.30 407197 2335828 874912.79 0 1956813 10683496 10683496 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 161791 (263265) 7.7% (12.6%) 57.6 5.13sec 1366955 1205252 Direct 57.6 269280 840160 840115 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.60 57.60 0.00 0.00 1.1342 0.0000 48390999.45 48390999.45 0.00 1205251.90 1205251.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 269279.99 227021 296490 1224.65 0 296490 1225 1225 0.00
crit 57.60 99.99% 840159.97 692614 1165090 840747.52 795981 902549 48389775 48389775 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 82937 4.0% 36.6 8.09sec 678562 0 Direct 36.6 221121 678582 678559 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.56 36.56 0.00 0.00 0.0000 0.0000 24808278.74 24808278.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 221120.97 190698 249052 414.08 0 249052 414 414 0.00
crit 36.56 99.99% 678582.20 559584 941311 679060.48 635926 750416 24807865 24807865 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18536 0.9% 43.0 6.41sec 128876 0 Direct 99.6 44791 91340 55600 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.97 99.60 0.00 0.00 0.0000 0.0000 5537417.67 5537417.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.47 76.78% 44791.40 42943 47934 44795.78 42943 47664 3425284 3425284 0.00
crit 23.12 23.22% 91340.21 87603 97785 91350.76 0 97785 2112134 2112134 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49511 (96258) 2.4% (4.6%) 41.0 7.08sec 705404 581151 Direct 41.0 226604 632569 362905 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.04 41.04 0.00 0.00 1.2138 0.0000 14893951.92 14893951.92 0.00 581151.40 581151.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.26 66.42% 226604.43 154272 604437 227755.71 171710 390687 6177154 6177154 0.00
crit 13.78 33.58% 632569.01 427024 1673082 633976.39 446116 1673082 8716798 8716798 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46747 2.2% 46.0 8.42sec 305591 0 Direct 46.0 191796 531748 305565 33.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.99 45.99 0.00 0.00 0.0000 0.0000 14055524.05 14055524.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.60 66.53% 191796.11 129588 507727 192239.77 146251 323066 5869239 5869239 0.00
crit 15.39 33.47% 531747.74 358700 1405389 532459.95 372337 1120107 8186285 8186285 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59955) 0.0% (2.8%) 3.0 120.34sec 5988182 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.85 0.00 0.0000 1.0000 0.00 0.00 0.00 308520.50 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19362 0.9% 38.0 6.84sec 151576 0 Direct 38.0 121869 248614 151577 23.4%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.01 38.01 0.00 0.00 0.0000 0.0000 5761498.02 5761498.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.10 76.56% 121869.49 121869 121869 121869.49 121869 121869 3546621 3546621 0.00
crit 8.91 23.44% 248613.77 248614 248614 248613.77 248614 248614 2214877 2214877 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40593 1.9% 98.8 2.61sec 122308 0 Direct 98.8 98655 201256 122308 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.82 98.82 0.00 0.00 0.0000 0.0000 12086104.19 12086104.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.04 76.95% 98654.92 98655 98655 98654.92 98655 98655 7501311 7501311 0.00
crit 22.78 23.05% 201256.04 201256 201256 201256.04 201256 201256 4584794 4584794 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143089 / 55172
Fire Blast 143089 2.6% 63.0 4.27sec 260731 145672 Direct 63.0 212291 424572 260731 22.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.04 63.04 0.00 0.00 1.7899 0.0000 16436493.91 16436493.91 0.00 145672.27 145672.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.66 77.18% 212291.37 199011 222144 212284.53 207661 219290 10329088 10329088 0.00
crit 14.38 22.82% 424572.03 398022 444288 424546.97 413274 444288 6107406 6107406 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185308 / 25161
Lightning Blast 185308 1.2% 40.1 7.04sec 188355 200987 Direct 40.1 153726 307515 188354 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.06 40.06 0.00 0.00 0.9372 0.0000 7546243.59 7546243.59 0.00 200986.62 200986.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.04 77.48% 153725.80 147415 164551 153772.41 148734 160948 4772139 4772139 0.00
crit 9.02 22.52% 307515.19 294831 329102 307620.21 294831 329102 2774105 2774105 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 181.72sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0345 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.27sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 0.00 0.00 0.8136 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.63sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5100 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.02% 32.02% 3.1(3.1) 7.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.7sec 25.8sec 31.59% 31.59% 1.3(1.3) 9.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.5sec 31.56% 31.56% 1.3(1.3) 9.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.56%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.5sec 30.63% 30.63% 1.6(1.6) 9.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.4 28.9 3.8sec 2.8sec 73.71% 68.26% 28.9(28.9) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.94%
  • elemental_focus_2:52.78%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.3 7.2 11.9sec 9.1sec 25.57% 42.71% 7.2(7.2) 1.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.57%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.74% 29.74% 4.3(4.3) 12.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 86.3sec 86.3sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:79.25%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.3sec 0.0sec 39.83% 39.83% 0.0(0.0) 1.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 45.8sec 31.7sec 31.41% 38.44% 2.4(5.9) 2.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.86%
  • power_of_the_maelstrom_2:7.03%
  • power_of_the_maelstrom_3:18.52%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.0sec 44.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.09%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.30% 9.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.60%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.5 9.1sec
Lava Surge: Wasted 7.3 30.7sec
Lava Surge: During Lava Burst 4.4 53.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6220.00116.64716.0080.00019.823
Fire Elemental0.3360.0011.2490.0970.0001.249
Ascendance1.8850.0018.7741.6550.0008.774
Lava Burst2.9200.00137.19644.29710.639101.104
Elemental Blast2.1260.00120.43935.60019.43460.104

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 78.9 9362.3 118.6 934.7 2149.7
earthquake Maelstrom 398.0 19899.1 50.0 393.9 11574.5
flame_shock Maelstrom 208.7 3951.1 18.9 149.2 6582.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 453.77 5387.28 (16.04%) 11.87 58.01 1.07%
Lava Burst Overload Maelstrom 288.02 2522.86 (7.51%) 8.76 69.35 2.68%
Lava Beam Maelstrom 59.60 1678.61 (5.00%) 28.17 44.79 2.60%
Lava Beam Overload Maelstrom 87.95 1654.09 (4.93%) 18.81 76.40 4.41%
Chain Lightning Maelstrom 351.70 8161.51 (24.30%) 23.21 151.02 1.82%
Chain Lightning Overload Maelstrom 424.86 7125.44 (21.22%) 16.77 407.43 5.41%
Lightning Bolt Maelstrom 323.30 2576.95 (7.67%) 7.97 9.44 0.36%
Lightning Bolt Overload Maelstrom 362.34 2152.65 (6.41%) 5.94 21.40 0.98%
Resonance Totem Maelstrom 2352.50 2322.54 (6.92%) 0.99 29.97 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.78 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T20M Fight Length
Count 7476
Mean 300.00
Minimum 239.95
Maximum 360.04
Spread ( max - min ) 120.09
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.5103
5th Percentile 245.10
95th Percentile 354.92
( 95th Percentile - 5th Percentile ) 109.82
Mean Distribution
Standard Deviation 0.4107
95.00% Confidence Intervall ( 299.19 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 539
0.1% Error 53824
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1077
DPS
Sample Data Shaman_Elemental_T20M Damage Per Second
Count 7476
Mean 2091941.05
Minimum 1706199.90
Maximum 2544827.52
Spread ( max - min ) 838627.62
Range [ ( max - min ) / 2 * 100% ] 20.04%
Standard Deviation 110656.2903
5th Percentile 1913847.75
95th Percentile 2282803.89
( 95th Percentile - 5th Percentile ) 368956.13
Mean Distribution
Standard Deviation 1279.7981
95.00% Confidence Intervall ( 2089432.69 - 2094449.41 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10749
0.1 Scale Factor Error with Delta=300 104528781
0.05 Scale Factor Error with Delta=300 418115121
0.01 Scale Factor Error with Delta=300 10452878001
Priority Target DPS
Sample Data Shaman_Elemental_T20M Priority Target Damage Per Second
Count 7476
Mean 962680.98
Minimum 835349.40
Maximum 1135091.01
Spread ( max - min ) 299741.61
Range [ ( max - min ) / 2 * 100% ] 15.57%
Standard Deviation 41796.2788
5th Percentile 896838.64
95th Percentile 1033137.49
( 95th Percentile - 5th Percentile ) 136298.84
Mean Distribution
Standard Deviation 483.3959
95.00% Confidence Intervall ( 961733.54 - 963628.42 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7242
0.1 Scale Factor Error with Delta=300 14912791
0.05 Scale Factor Error with Delta=300 59651161
0.01 Scale Factor Error with Delta=300 1491279004
DPS(e)
Sample Data Shaman_Elemental_T20M Damage Per Second (Effective)
Count 7476
Mean 2091941.05
Minimum 1706199.90
Maximum 2544827.52
Spread ( max - min ) 838627.62
Range [ ( max - min ) / 2 * 100% ] 20.04%
Damage
Sample Data Shaman_Elemental_T20M Damage
Count 7476
Mean 602614805.17
Minimum 432709636.88
Maximum 816468683.16
Spread ( max - min ) 383759046.28
Range [ ( max - min ) / 2 * 100% ] 31.84%
DTPS
Sample Data Shaman_Elemental_T20M Damage Taken Per Second
Count 7476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T20M Healing Per Second
Count 7476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T20M Healing Per Second (Effective)
Count 7476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T20M Heal
Count 7476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T20M Healing Taken Per Second
Count 7476
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T20M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Shaman_Elemental_T20MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shaman_Elemental_T20M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.97 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.95 totem_mastery,if=buff.resonance_totem.remains<2
9 1.93 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.88 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.80 stormkeeper
G 0.14 ascendance
0.00 liquid_magma_totem
H 1.99 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 48.79 earthquake
J 1.60 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.65 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.31 lava_beam
M 35.20 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.79 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.87 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.75 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 17.80 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.61 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.01 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.21 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.70 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.88 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.56 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.42 lightning_bolt
e 0.14 flame_shock,moving=1,target_if=refreshable
f 0.36 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWTWWWSLILIILLIIMHWWXSXbbWbWTccXcXcSWMIIMIMIMISWWXXbbbWcXSdWdWFIIMIMIMISWWXccccTWWSXcQWIMMIMMIMSWW8WAXXWWWTdSWWQWIMFIIMIMIISVWWXXbWbbdTWSXcWQWMIIMMIIMSWWRXXdWdWdPWSTWWWILIFLILISV97WWbTWbXXWSXbbWIMIMIMIMIJ8KJAMIMMIIMMQSWWIMIMFIMIIKMIJWddWXXWWSWTdMMIIIMMISWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.965 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.003 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.040 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.820 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.599 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.378 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.157 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.157 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.193 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, ascendance, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.230 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.008 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.786 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.821 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.856 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.941 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.045 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.082 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.863 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.899 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.675 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.452 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.490 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.527 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.306 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.085 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.121 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.899 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.676 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.763 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.579 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.665 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.482 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.569 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.657 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.456 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.521 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.587 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.387 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.451 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.516 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.315 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.401 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.219 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.628 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.039 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.385 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.732 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.743 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.753 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.099 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.110 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.456 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.468 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.813 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.871 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.448 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.457 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.804 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.813 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.805 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.126 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.446 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.767 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.087 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.432 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.492 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.902 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.247 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.257 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.602 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.949 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.942 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.935 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.926 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.916 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.907 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.944 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.005 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.065 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.125 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.537 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.597 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.010 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.070 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.482 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:32.893 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:34.304 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:35.716 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:36.775 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:37.833 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:39.245 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:40.628 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:41.667 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:43.051 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:44.089 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:45.128 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:46.165 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:47.549 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:48.934 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:49.972 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:51.354 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.738 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.797 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.207 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:56.591 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:57.975 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:59.013 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:59.767 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.150 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:01.150 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.210 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:03.269 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.327 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:05.388 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:06.799 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:07.857 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.268 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.679 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.737 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.148 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:14.209 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:15.266 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.324 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.736 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.796 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.857 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.916 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.976 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.036 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:23.790 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:24.547 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:25.302 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:26.284 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:27.039 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:27.977 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:28.914 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:29.667 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:30.422 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:31.359 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:32.114 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:33.053 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:33.987 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:35.569 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:36.735 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:38.362 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:39.990 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:41.154 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:42.738 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.748 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.758 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.106 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.454 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.465 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.474 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.821 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.233 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.291 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.330 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.713 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.097 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.088 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.409 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.419 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.429 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.440 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.786 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.796 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.144 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.465 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.787 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.787 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.170 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.556 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.548 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.540 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.861 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.183 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.174 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.494 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:19.485 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:20.476 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.822 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.880 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.293 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.353 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.766 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.825 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.010 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.010 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:30.019 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:31.366 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:32.687 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:33.679 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:34.670 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:35.990 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:36.981 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:37.991 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:39.402 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:40.814 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:41.874 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.284 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:44.694 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:45.754 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.813 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:48.224 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:49.284 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:50.695 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:51.756 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:53.165 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:54.224 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.636 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:56.697 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.755 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.510 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.920 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.930 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.930 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:02.277 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.287 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.634 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:05.981 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:06.992 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:08.002 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.348 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.695 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.753 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:13.327 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:14.739 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:16.123 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:17.162 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:18.544 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:19.583 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:20.966 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:22.024 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:23.085 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:24.145 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.205 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.265 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:27.678 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.739 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:29.798 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.857 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.269 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.328 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.739 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.799 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.859 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.918 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.979 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.390 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.801 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.860 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.920 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.331 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.742 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.153 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.210 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.269 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.308 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.690 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.073 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.111 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.495 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.906 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.317 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81584 81584 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4895040 4895040 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ctt_nature : 2099330 dps, 966736 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2099329.8 2099329.8 2516.3 / 0.120% 435338.9 / 20.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ctt_nature 2099330
Chain Lightning 200954 (437182) 9.6% (20.9%) 44.5 6.02sec 2957011 2366606 Direct 175.3 246099 679739 344966 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.49 175.26 0.00 0.00 1.2495 0.0000 60459064.76 60459064.76 0.00 2366606.04 2366606.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.30 77.20% 246098.65 148596 582201 246623.24 169744 305381 33295586 33295586 0.00
crit 39.96 22.80% 679739.40 411315 1611532 680680.84 452652 967605 27163479 27163479 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 236228 11.3% 53.8 9.04sec 1322044 0 Direct 238.2 212823 587500 298525 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.78 238.16 0.00 0.00 0.0000 0.0000 71095831.69 71095831.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.68 77.13% 212823.15 124821 489049 213087.40 139037 316529 39091750 39091750 0.00
crit 54.48 22.87% 587499.85 345504 1353687 588518.27 382840 912881 32004082 32004082 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast3
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67503 3.2% 10.0 30.09sec 2019278 2121498 Direct 10.0 1430993 3964791 2019361 23.2%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9519 0.0000 20251822.45 20251822.45 0.00 2121498.27 2121498.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.70 76.78% 1430993.43 103242 1685435 1433518.10 917288 1628199 11019424 11019424 0.00
crit 2.33 23.22% 3964790.87 334357 4665285 3644763.81 0 4665285 9232399 9232399 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (770376) 0.0% (36.7%) 50.5 5.57sec 4576540 4677902

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.47 0.00 0.00 0.00 0.9783 0.0000 0.00 0.00 0.00 4677901.69 4677901.69
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 568583 27.1% 299.3 0.93sec 569539 0 Direct 1536.3 79627 220450 110973 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.34 1536.29 0.00 0.00 0.0000 0.0000 170485388.17 170485388.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1194.33 77.74% 79626.98 68550 89526 79663.00 75410 84563 95101267 95101267 0.00
crit 341.96 22.26% 220449.73 189746 247808 220546.84 207291 234237 75384121 75384121 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 201793 9.6% 76.9 4.14sec 786526 0 Direct 76.9 564200 1561562 786558 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.93 76.93 0.00 0.00 0.0000 0.0000 60509397.23 60509397.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.78 77.71% 564200.20 541752 604726 564332.88 547924 587877 33729467 33729467 0.00
crit 17.15 22.29% 1561562.01 1499569 1673881 1562064.45 1499569 1656450 26779930 26779930 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57656 (88160) 2.7% (4.2%) 20.0 15.20sec 1320326 999920 Direct 20.0 613676 1698920 863531 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.3204 0.0000 17292309.06 17292309.06 0.00 999920.15 999920.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.41 76.98% 613676.18 526273 687314 613733.31 565251 655418 9459698 9459698 0.00
crit 4.61 23.02% 1698920.23 1456724 1902485 1686808.62 0 1902485 7832611 7832611 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30505 1.5% 12.6 23.24sec 724293 0 Direct 12.6 515472 1428119 724349 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.63 12.63 0.00 0.00 0.0000 0.0000 9147579.67 9147579.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.74 77.12% 515472.12 442069 577344 515542.21 457100 565782 5020529 5020529 0.00
crit 2.89 22.88% 1428119.04 1223648 1598088 1358387.02 0 1598088 4127050 4127050 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86894 4.1% 26.5 11.28sec 983108 1022757 Direct 26.5 92544 256525 130572 23.2%  
Periodic 316.5 50708 140356 71327 23.0% 133.3%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.48 26.48 316.51 316.51 0.9612 1.2634 26033244.18 26033244.18 0.00 61207.45 1022756.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.34 76.81% 92544.34 77837 101655 92409.15 82014 97278 1882333 1882333 0.00
crit 6.14 23.19% 256524.67 215453 281381 254973.01 0 281381 1575234 1575234 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.7 77.00% 50708.03 26 55911 50678.32 46283 53020 12357851 12357851 0.00
crit 72.8 23.00% 140355.83 94 154763 140274.30 126927 146936 10217827 10217827 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65354 (147126) 3.1% (6.9%) 7.6 28.82sec 5760909 4920210 Direct 36.4 381659 1050843 530852 22.3%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 36.41 0.00 0.00 1.1710 0.0000 19327479.20 19327479.20 0.00 4920210.27 4920210.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.29 77.71% 381659.35 175131 1004613 382677.78 226550 664759 10797888 10797888 0.00
crit 8.12 22.29% 1050843.14 484763 2780769 1047838.10 0 2376725 8529591 8529591 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 81771 3.8% 11.2 40.99sec 2163718 0 Direct 55.0 316168 873362 439610 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 55.01 0.00 0.00 0.0000 0.0000 24181940.19 24181940.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.82 77.85% 316168.44 147109 843868 317119.31 177578 618548 13539532 13539532 0.00
crit 12.19 22.15% 873361.60 407197 2335828 874696.55 0 2140350 10642408 10642408 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162314 (264333) 7.7% (12.6%) 57.8 5.10sec 1368245 1207073 Direct 57.8 257641 840239 840207 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.78 57.78 0.00 0.00 1.1335 0.0000 48550649.43 48550649.43 0.00 1207073.06 1207073.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 257640.97 227021 296490 818.12 0 296490 818 818 0.00
crit 57.78 99.99% 840238.50 692614 1165090 840796.25 799976 902430 48549831 48549831 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83305 4.0% 36.7 7.99sec 678643 0 Direct 36.7 216977 678674 678644 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.72 36.72 0.00 0.00 0.0000 0.0000 24919684.97 24919684.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 216977.14 190698 239077 487.23 0 239077 517 517 0.00
crit 36.72 99.99% 678673.58 559584 941311 679140.69 638022 743251 24919168 24919168 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18714 0.9% 43.2 6.32sec 129496 0 Direct 100.5 44806 91372 55646 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.19 100.51 0.00 0.00 0.0000 0.0000 5592951.11 5592951.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.12 76.72% 44806.48 42943 47934 44810.84 43096 47649 3455252 3455252 0.00
crit 23.40 23.28% 91372.11 87603 97785 91366.51 0 97785 2137699 2137699 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49996 (97353) 2.4% (4.7%) 41.1 7.17sec 711974 586850 Direct 41.1 229228 637410 365720 33.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.11 41.11 0.00 0.00 1.2132 0.0000 15036088.99 15036088.99 0.00 586849.55 586849.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.37 66.56% 229228.17 155755 610249 230215.96 176517 381635 6272773 6272773 0.00
crit 13.75 33.44% 637410.39 431130 1689170 639674.98 431130 1261178 8763316 8763316 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 47357 2.3% 46.1 8.53sec 308824 0 Direct 46.1 193254 536902 308819 33.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.10 46.10 0.00 0.00 0.0000 0.0000 14235379.95 14235379.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.59 66.37% 193254.30 130834 512609 193697.44 144149 335344 5911824 5911824 0.00
crit 15.50 33.63% 536901.85 362149 1418903 538245.05 380196 1140253 8323556 8323556 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59992) 0.0% (2.8%) 3.0 120.33sec 5983946 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.94 0.00 0.0000 1.0000 0.00 0.00 0.00 308290.14 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19334 0.9% 38.1 6.87sec 151149 0 Direct 38.1 121869 248614 151149 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.08 38.08 0.00 0.00 0.0000 0.0000 5755721.08 5755721.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.28 76.90% 121869.49 121869 121869 121869.49 121869 121869 3568690 3568690 0.00
crit 8.80 23.10% 248613.77 248614 248614 248547.98 0 248614 2187031 2187031 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40658 1.9% 99.0 2.61sec 122317 0 Direct 99.0 98655 201256 122317 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.96 98.96 0.00 0.00 0.0000 0.0000 12105068.06 12105068.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.14 76.94% 98654.92 98655 98655 98654.92 98655 98655 7511728 7511728 0.00
crit 22.82 23.06% 201256.04 201256 201256 201256.04 201256 201256 4593340 4593340 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143212 / 55311
Fire Blast 143212 2.6% 63.1 4.26sec 261112 145817 Direct 63.1 212285 424562 261112 23.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.11 63.11 0.00 0.00 1.7907 0.0000 16478391.34 16478391.34 0.00 145817.44 145817.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.59 77.00% 212284.56 199011 222144 212282.65 207680 219165 10315380 10315380 0.00
crit 14.52 23.00% 424561.68 398022 444288 424560.74 413592 444288 6163012 6163012 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 184950 / 25099
Lightning Blast 184950 1.2% 40.0 7.03sec 188383 200709 Direct 40.0 153731 307666 188380 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.96 39.96 0.00 0.00 0.9386 0.0000 7528382.67 7528382.67 0.00 200708.70 200708.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.97 77.49% 153730.59 147415 164551 153771.34 148880 161776 4760594 4760594 0.00
crit 9.00 22.51% 307666.45 294831 329102 307751.66 0 329102 2767789 2767789 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ctt_nature
Ascendance 2.0 181.66sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0324 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.15sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8137 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5093 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.6sec 181.6sec 10.14% 15.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.17% 32.17% 3.1(3.1) 8.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.6sec 25.6sec 31.70% 31.70% 1.3(1.3) 9.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.7sec 25.8sec 31.40% 31.40% 1.3(1.3) 9.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.5sec 30.60% 30.60% 1.6(1.6) 9.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.4 28.8 3.8sec 2.8sec 73.70% 68.24% 28.8(28.8) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.95%
  • elemental_focus_2:52.75%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.5 7.2 11.8sec 9.1sec 25.71% 43.02% 7.3(7.3) 1.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.71%

Trigger Attempt Success

  • trigger_pct:99.82%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.78% 29.78% 4.2(4.2) 12.6

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.9sec 85.9sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.29%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.54% 13.54% 0.0(0.0) 3.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.3sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.7sec 31.4sec 31.65% 38.52% 2.5(6.0) 2.1

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.04%
  • power_of_the_maelstrom_2:7.16%
  • power_of_the_maelstrom_3:18.46%

Trigger Attempt Success

  • trigger_pct:15.09%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.6sec 44.6sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.02%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.34% 9.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.13%
  • stormkeeper_2:3.61%
  • stormkeeper_3:3.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.09% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.8 9.0sec
Lava Surge: Wasted 7.4 30.5sec
Lava Surge: During Lava Burst 4.4 53.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6120.00116.66115.9680.00019.743
Fire Elemental0.3430.0021.2480.0990.0001.248
Ascendance1.8530.0019.3901.6470.0009.390
Lava Burst2.9120.00135.22344.35610.466107.112
Elemental Blast2.1230.00118.19835.59018.75372.870

Resources

Resource Usage Type Count Total Average RPE APR
ctt_nature
earth_shock Maelstrom 75.6 8974.4 118.6 894.8 2256.6
earthquake Maelstrom 380.7 19037.5 50.0 377.2 12133.7
flame_shock Maelstrom 199.7 3781.9 18.9 142.8 6883.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 435.87 5175.71 (16.10%) 11.87 54.73 1.05%
Lava Burst Overload Maelstrom 276.98 2426.68 (7.55%) 8.76 66.12 2.65%
Lava Beam Maelstrom 56.97 1604.13 (4.99%) 28.16 43.66 2.65%
Lava Beam Overload Maelstrom 84.31 1584.31 (4.93%) 18.79 75.66 4.56%
Chain Lightning Maelstrom 335.59 7791.34 (24.24%) 23.22 140.90 1.78%
Chain Lightning Overload Maelstrom 405.67 6800.50 (21.16%) 16.76 385.93 5.37%
Lightning Bolt Maelstrom 310.13 2471.91 (7.69%) 7.97 9.15 0.37%
Lightning Bolt Overload Maelstrom 347.68 2066.62 (6.43%) 5.94 19.47 0.93%
Resonance Totem Maelstrom 2252.68 2224.29 (6.92%) 0.99 28.39 1.26%
Resource RPS-Gain RPS-Loss
Maelstrom 14.20 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.85 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ctt_nature Fight Length
Count 7558
Mean 300.01
Minimum 239.95
Maximum 360.03
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.0125
5th Percentile 246.20
95th Percentile 353.81
( 95th Percentile - 5th Percentile ) 107.61
Mean Distribution
Standard Deviation 0.4027
95.00% Confidence Intervall ( 299.22 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 524
0.1% Error 52320
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1047
DPS
Sample Data ctt_nature Damage Per Second
Count 7558
Mean 2099329.78
Minimum 1733194.38
Maximum 2554631.78
Spread ( max - min ) 821437.41
Range [ ( max - min ) / 2 * 100% ] 19.56%
Standard Deviation 111614.7760
5th Percentile 1922470.95
95th Percentile 2288667.32
( 95th Percentile - 5th Percentile ) 366196.37
Mean Distribution
Standard Deviation 1283.8617
95.00% Confidence Intervall ( 2096813.46 - 2101846.11 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10859
0.1 Scale Factor Error with Delta=300 106347444
0.05 Scale Factor Error with Delta=300 425389773
0.01 Scale Factor Error with Delta=300 10634744319
Priority Target DPS
Sample Data ctt_nature Priority Target Damage Per Second
Count 7558
Mean 966736.39
Minimum 825916.23
Maximum 1130204.53
Spread ( max - min ) 304288.30
Range [ ( max - min ) / 2 * 100% ] 15.74%
Standard Deviation 42321.6305
5th Percentile 901060.94
95th Percentile 1038945.67
( 95th Percentile - 5th Percentile ) 137884.73
Mean Distribution
Standard Deviation 486.8094
95.00% Confidence Intervall ( 965782.26 - 967690.52 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7363
0.1 Scale Factor Error with Delta=300 15290034
0.05 Scale Factor Error with Delta=300 61160136
0.01 Scale Factor Error with Delta=300 1529003398
DPS(e)
Sample Data ctt_nature Damage Per Second (Effective)
Count 7558
Mean 2099329.78
Minimum 1733194.38
Maximum 2554631.78
Spread ( max - min ) 821437.41
Range [ ( max - min ) / 2 * 100% ] 19.56%
Damage
Sample Data ctt_nature Damage
Count 7558
Mean 604979600.19
Minimum 419085367.40
Maximum 815416279.39
Spread ( max - min ) 396330911.98
Range [ ( max - min ) / 2 * 100% ] 32.76%
DTPS
Sample Data ctt_nature Damage Taken Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ctt_nature Healing Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ctt_nature Healing Per Second (Effective)
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ctt_nature Heal
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ctt_nature Healing Taken Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ctt_nature Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ctt_natureTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ctt_nature Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.97 totem_mastery,if=buff.resonance_totem.remains<2
9 1.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.91 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.83 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.01 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.28 earthquake
J 1.63 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.63 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.37 lava_beam
M 35.42 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.80 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.95 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.76 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.03 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.68 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 1.99 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.97 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.91 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.75 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.15 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.68 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.67 lightning_bolt
e 0.14 flame_shock,moving=1,target_if=refreshable
f 0.36 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRVVVPWWTWWWWILILLIILIMMSWWXXbbbYdWWXXSbbXbWIMIIIMMIISWWXXbbbWcXSddWFIIMIMIIMISWWHbbbcWTWSWdQXMIMIIMIMMSW8WAXXWbXWWYbSWbddWIFIMIMIIMISWWXbbbdYWdXSWXWXdWMIIIMIMIMSWWRXXddWWPWWSTWWWWILFILIIIMISVW97WbeWbdTWSWWbIMIMIMIMIS8WWbAbTWbWbQSbbWIIMFIMIMMISWddWWddTdQSWddMIIMMIMIMSWWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.940 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.006 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.023 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.786 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.548 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.313 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.091 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.091 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.128 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.163 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.941 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.977 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.012 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.049 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.134 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.951 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.037 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.853 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.940 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.026 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.842 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.659 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.745 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.561 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.649 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.737 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.822 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.601 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.640 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.418 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.198 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.235 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.272 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.309 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.088 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.125 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.903 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.941 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.756 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.572 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.907 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.921 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.937 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.928 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.250 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.242 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.234 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.554 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.545 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.536 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.527 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.939 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.351 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.411 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.471 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.884 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.945 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.357 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.417 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.476 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.887 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.298 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.710 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.121 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.533 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.594 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.006 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.352 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.700 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.047 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.059 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.070 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.080 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.090 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.100 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.110 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.171 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.232 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.291 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.351 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.763 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.773 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.120 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.130 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.476 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.797 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.117 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:35.437 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:36.758 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:37.798 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:38.838 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:40.221 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:41.632 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:43.045 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:44.103 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:45.140 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:46.523 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:47.562 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:48.946 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:49.985 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:51.023 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.434 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.493 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.903 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.314 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.725 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.783 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.537 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.948 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.948 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.007 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.068 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.128 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.541 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.601 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:07.356 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:08.319 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:09.074 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:10.035 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:10.997 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:11.752 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:12.669 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:13.607 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:14.544 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:15.298 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:16.052 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:16.806 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:17.560 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:18.315 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:19.502 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:20.693 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:21.881 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:23.128 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:24.374 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:25.620 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:27.279 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.626 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.973 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.984 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.331 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.677 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.024 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.344 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:37.098 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:38.016 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:38.978 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:39.733 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:40.696 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:41.449 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:42.203 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:42.958 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:43.713 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:44.650 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:45.586 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:46.522 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:47.276 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:48.033 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:48.785 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:50.367 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:51.555 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:53.215 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:54.434 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:56.060 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:57.688 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.009 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.330 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.320 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.331 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.340 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.687 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.032 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.026 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:07.944 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:08.091 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:09.052 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:09.805 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:10.768 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:11.522 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:12.441 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:13.379 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:14.315 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:15.252 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:16.006 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:16.925 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:17.681 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:18.433 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:19.988 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:21.155 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom ascendance, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:22.321 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:23.545 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:24.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:25.988 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:27.648 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.658 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.669 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.680 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.680 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.027 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:33.036 single_asc e flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom movement, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:34.047 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:35.058 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:36.405 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:37.751 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:38.811 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:40.222 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:41.634 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:42.645 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.655 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:45.003 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:46.014 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:47.362 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:48.371 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:49.717 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:50.727 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:52.072 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:53.131 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:54.541 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:55.602 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:57.014 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:57.768 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:58.780 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:00.126 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.475 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.475 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.821 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.830 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.840 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:06.185 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.532 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.945 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.005 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:11.417 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.764 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.776 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.122 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.132 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.145 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.493 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:19.485 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:20.477 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:21.470 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:22.509 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:23.549 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:24.587 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.646 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:27.057 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.406 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:29.753 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:31.100 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.110 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.455 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.801 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.148 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.158 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.570 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.629 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.040 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.387 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.734 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.081 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.428 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.439 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.449 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.796 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.143 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.181 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.566 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.605 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.988 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.371 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.431 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.844 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ctt_nature"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:5:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ea_es : 2092711 dps, 965240 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2092711.1 2092711.1 2510.0 / 0.120% 438311.8 / 20.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ea_es 2092711
Chain Lightning 199192 (433299) 9.6% (20.8%) 44.6 5.96sec 2922557 2339161 Direct 175.8 243257 671383 341001 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.62 175.76 0.00 0.00 1.2494 0.0000 59937261.95 59937261.95 0.00 2339161.16 2339161.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.63 77.17% 243257.36 147181 576656 243779.68 166121 307280 32994319 32994319 0.00
crit 40.13 22.83% 671382.79 407397 1596184 672236.09 447675 977023 26942942 26942942 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 234107 11.2% 53.9 8.98sec 1307508 0 Direct 238.6 210910 580271 295300 22.8%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.90 238.63 0.00 0.00 0.0000 0.0000 70468633.32 70468633.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.11 77.15% 210910.49 123632 484391 211153.39 138212 323385 38832080 38832080 0.00
crit 54.52 22.85% 580271.14 342214 1340795 581621.36 380271 890797 31636553 31636553 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 69318 3.3% 10.0 30.22sec 2076218 2181009 Direct 10.0 1465254 4062228 2076138 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9520 0.0000 20815545.64 20815545.64 0.00 2181008.55 2181008.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.67 76.48% 1465253.84 105785 1726949 1467843.41 1003496 1685457 11234682 11234682 0.00
crit 2.36 23.52% 4062228.39 342592 4780194 3761211.90 0 4780194 9580864 9580864 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (768600) 0.0% (36.7%) 50.5 5.55sec 4558575 4660925

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.54 0.00 0.00 0.00 0.9780 0.0000 0.00 0.00 0.00 4660925.30 4660925.30
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 569034 27.2% 299.8 0.93sec 568963 0 Direct 1537.4 79621 220447 110957 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.81 1537.37 0.00 0.00 0.0000 0.0000 170583427.58 170583427.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.28 77.75% 79620.78 68550 89526 79657.25 75818 83834 95169224 95169224 0.00
crit 342.10 22.25% 220447.04 189746 247808 220547.84 208897 232936 75414204 75414204 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199566 9.5% 76.9 4.13sec 778260 0 Direct 76.9 558774 1546442 778249 22.2%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.87 76.87 0.00 0.00 0.0000 0.0000 59824753.66 59824753.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.79 77.78% 558774.35 536592 598966 558901.99 543512 581916 33407938 33407938 0.00
crit 17.08 22.22% 1546441.75 1485287 1657939 1546750.20 1491324 1629164 26416816 26416816 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast4
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57087 (87334) 2.7% (4.2%) 20.0 15.22sec 1309488 991239 Direct 20.0 607974 1683005 856114 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 1.3211 0.0000 17123210.58 17123210.58 0.00 991238.51 991238.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.39 76.92% 607973.81 521261 680768 608058.26 560462 651519 9354367 9354367 0.00
crit 4.62 23.08% 1683004.94 1442850 1884366 1670345.85 0 1884366 7768843 7768843 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30247 1.4% 12.6 23.31sec 718445 0 Direct 12.6 510624 1414237 718390 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.62 12.62 0.00 0.00 0.0000 0.0000 9069275.90 9069275.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.72 77.00% 510623.98 437859 571845 510692.06 461357 566119 4963570 4963570 0.00
crit 2.90 23.00% 1414236.73 1211994 1582868 1347455.74 0 1582868 4105706 4105706 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86817 4.1% 26.4 11.30sec 983836 1023118 Direct 26.4 92545 256606 130715 23.3%  
Periodic 316.2 50714 140412 71321 23.0% 133.2%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.43 26.43 316.16 316.16 0.9616 1.2636 26004589.09 26004589.09 0.00 61200.08 1023117.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.28 76.73% 92545.00 77837 101655 92404.75 82955 97461 1876950 1876950 0.00
crit 6.15 23.27% 256605.98 215453 281381 255398.35 0 281381 1578238 1578238 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.5 77.03% 50714.23 26 55911 50683.12 46299 53067 12350434 12350434 0.00
crit 72.6 22.97% 140411.83 106 154763 140325.59 127555 147709 10198967 10198967 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65199 (146923) 3.1% (6.9%) 7.6 28.67sec 5739303 4904922 Direct 36.4 380990 1053611 529630 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.57 36.40 0.00 0.00 1.1702 0.0000 19278051.52 19278051.52 0.00 4904922.18 4904922.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.36 77.91% 380990.05 175131 1004613 381973.97 231300 591982 10804381 10804381 0.00
crit 8.04 22.09% 1053610.82 484763 2780769 1049023.66 506435 2602567 8473670 8473670 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 81724 3.9% 11.2 40.87sec 2153716 0 Direct 55.1 314441 868358 437864 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 55.14 0.00 0.00 0.0000 0.0000 24145224.55 24145224.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.86 77.72% 314440.86 147109 843868 315344.90 182211 679874 13474935 13474935 0.00
crit 12.29 22.28% 868357.63 407197 2335828 873505.33 0 2086769 10670289 10670289 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162076 (263828) 7.7% (12.6%) 57.7 5.12sec 1367503 1206166 Direct 57.7 255025 840198 840157 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.70 57.70 0.00 0.00 1.1338 0.0000 48479155.40 48479155.40 0.00 1206165.57 1206165.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 255024.68 227021 296490 1031.41 0 296490 1031 1031 0.00
crit 57.70 99.99% 840198.08 692614 1165090 840753.03 801350 897209 48478124 48478124 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83100 4.0% 36.6 8.04sec 678526 0 Direct 36.6 223512 678554 678529 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.63 36.63 0.00 0.00 0.0000 0.0000 24854312.77 24854312.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 223511.86 190698 249052 437.40 0 249052 437 437 0.00
crit 36.63 99.99% 678553.70 559584 941311 679013.12 625917 734810 24853875 24853875 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18653 0.9% 43.1 6.27sec 129337 0 Direct 100.4 44792 91308 55527 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.11 100.40 0.00 0.00 0.0000 0.0000 5575089.88 5575089.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.23 76.92% 44791.58 42943 47934 44793.24 42976 47416 3459128 3459128 0.00
crit 23.17 23.08% 91308.34 87603 97785 91301.11 0 97785 2115962 2115962 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49565 (96210) 2.4% (4.6%) 41.0 7.20sec 705072 581246 Direct 41.0 227228 632613 363260 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.05 41.05 0.00 0.00 1.2131 0.0000 14910664.30 14910664.30 0.00 581245.67 581245.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.27 66.44% 227227.71 154272 604437 228289.02 174113 382965 6197127 6197127 0.00
crit 13.77 33.56% 632612.73 427024 1673082 634809.27 455530 1228355 8713538 8713538 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46644 2.2% 45.9 8.57sec 305842 0 Direct 45.9 191676 533107 305858 33.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.88 45.88 0.00 0.00 0.0000 0.0000 14031882.45 14031882.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.53 66.55% 191675.89 129588 507727 192065.34 145224 344469 5852500 5852500 0.00
crit 15.34 33.45% 533107.48 358700 1405389 534292.50 385572 1143537 8179383 8179383 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (60029) 0.0% (2.9%) 3.0 120.33sec 5985488 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.95 0.00 0.0000 1.0000 0.00 0.00 0.00 308413.82 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19340 0.9% 38.1 6.84sec 151122 0 Direct 38.1 121869 248614 151125 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.10 38.10 0.00 0.00 0.0000 0.0000 5758063.14 5758063.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 76.92% 121869.49 121869 121869 121869.49 121869 121869 3571754 3571754 0.00
crit 8.79 23.08% 248613.77 248614 248614 248613.77 248614 248614 2186309 2186309 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40689 1.9% 99.0 2.61sec 122338 0 Direct 99.0 98655 201256 122336 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.02 99.02 0.00 0.00 0.0000 0.0000 12113284.05 12113284.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.16 76.92% 98654.92 98655 98655 98654.92 98655 98655 7513592 7513592 0.00
crit 22.85 23.08% 201256.04 201256 201256 201256.04 201256 201256 4599692 4599692 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143021 / 55242
Fire Blast 143021 2.6% 63.1 4.27sec 260667 145613 Direct 63.1 212278 424524 260670 22.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.13 63.13 0.00 0.00 1.7901 0.0000 16456619.37 16456619.37 0.00 145613.18 145613.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.74 77.20% 212278.50 199011 222144 212271.01 207400 219165 10346349 10346349 0.00
crit 14.39 22.80% 424524.08 398022 444288 424539.84 412851 444288 6110271 6110271 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185086 / 25111
Lightning Blast 185086 1.2% 40.0 7.06sec 188399 200856 Direct 40.0 153753 307651 188398 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.99 39.99 0.00 0.00 0.9380 0.0000 7534321.93 7534321.93 0.00 200856.33 200856.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.99 77.49% 153752.82 147415 164551 153800.52 149063 161864 4764537 4764537 0.00
crit 9.00 22.51% 307650.87 294831 329102 307655.13 0 329102 2769785 2769785 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ea_es
Ascendance 2.0 181.72sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0330 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.08sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8138 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5092 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.80% 0.0(0.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.03% 32.03% 3.1(3.1) 7.9

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.7sec 25.8sec 31.52% 31.52% 1.3(1.3) 9.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.7sec 31.52% 31.52% 1.3(1.3) 9.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.6sec 25.6sec 30.58% 30.58% 1.6(1.6) 9.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.4 28.8 3.8sec 2.8sec 73.72% 68.28% 28.8(28.8) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.90%
  • elemental_focus_2:52.82%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.4 7.2 11.8sec 9.1sec 25.64% 42.95% 7.2(7.2) 1.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.64%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.78% 29.78% 4.2(4.2) 12.6

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.6sec 85.6sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:77.95%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.53% 13.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.4sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 46.0sec 31.6sec 31.20% 38.21% 2.4(6.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.84%
  • power_of_the_maelstrom_2:7.09%
  • power_of_the_maelstrom_3:18.27%

Trigger Attempt Success

  • trigger_pct:14.94%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.4sec 44.4sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.02%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.32% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.61%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.09% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.6 9.1sec
Lava Surge: Wasted 7.3 30.7sec
Lava Surge: During Lava Burst 4.4 53.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5810.00116.65515.9270.07520.197
Fire Elemental0.3380.0011.2480.0970.0001.248
Ascendance1.8730.0018.8661.6520.0008.866
Lava Burst2.9180.00136.65044.3369.030100.547
Elemental Blast2.1320.00120.07635.72819.57060.215

Resources

Resource Usage Type Count Total Average RPE APR
ea_es
earth_shock Maelstrom 78.1 9261.1 118.6 923.7 2247.6
earthquake Maelstrom 393.7 19686.7 50.0 389.5 11703.7
flame_shock Maelstrom 205.9 3898.3 18.9 147.5 6670.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 449.50 5336.95 (16.07%) 11.87 57.05 1.06%
Lava Burst Overload Maelstrom 285.36 2501.15 (7.53%) 8.76 67.11 2.61%
Lava Beam Maelstrom 58.94 1657.46 (4.99%) 28.12 43.83 2.58%
Lava Beam Overload Maelstrom 87.33 1637.75 (4.93%) 18.75 80.39 4.68%
Chain Lightning Maelstrom 347.58 8070.03 (24.30%) 23.22 144.52 1.76%
Chain Lightning Overload Maelstrom 419.81 7036.43 (21.19%) 16.76 398.58 5.36%
Lightning Bolt Maelstrom 319.76 2548.84 (7.67%) 7.97 9.21 0.36%
Lightning Bolt Overload Maelstrom 357.40 2124.31 (6.40%) 5.94 20.09 0.94%
Resonance Totem Maelstrom 2326.31 2297.24 (6.92%) 0.99 29.07 1.25%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 48.07 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ea_es Fight Length
Count 7665
Mean 300.02
Minimum 239.92
Maximum 360.07
Spread ( max - min ) 120.15
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.9752
5th Percentile 246.03
95th Percentile 353.98
( 95th Percentile - 5th Percentile ) 107.94
Mean Distribution
Standard Deviation 0.3995
95.00% Confidence Intervall ( 299.24 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 523
0.1% Error 52206
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1045
DPS
Sample Data ea_es Damage Per Second
Count 7665
Mean 2092711.13
Minimum 1688945.69
Maximum 2620750.34
Spread ( max - min ) 931804.65
Range [ ( max - min ) / 2 * 100% ] 22.26%
Standard Deviation 112117.8607
5th Percentile 1917861.36
95th Percentile 2286834.70
( 95th Percentile - 5th Percentile ) 368973.33
Mean Distribution
Standard Deviation 1280.6154
95.00% Confidence Intervall ( 2090201.17 - 2095221.09 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11027
0.1 Scale Factor Error with Delta=300 107308290
0.05 Scale Factor Error with Delta=300 429233159
0.01 Scale Factor Error with Delta=300 10730828974
Priority Target DPS
Sample Data ea_es Priority Target Damage Per Second
Count 7665
Mean 965239.84
Minimum 831342.59
Maximum 1137789.36
Spread ( max - min ) 306446.76
Range [ ( max - min ) / 2 * 100% ] 15.87%
Standard Deviation 42363.4134
5th Percentile 897944.66
95th Percentile 1036799.69
( 95th Percentile - 5th Percentile ) 138855.03
Mean Distribution
Standard Deviation 483.8769
95.00% Confidence Intervall ( 964291.46 - 966188.22 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7400
0.1 Scale Factor Error with Delta=300 15320240
0.05 Scale Factor Error with Delta=300 61280959
0.01 Scale Factor Error with Delta=300 1532023970
DPS(e)
Sample Data ea_es Damage Per Second (Effective)
Count 7665
Mean 2092711.13
Minimum 1688945.69
Maximum 2620750.34
Spread ( max - min ) 931804.65
Range [ ( max - min ) / 2 * 100% ] 22.26%
Damage
Sample Data ea_es Damage
Count 7665
Mean 602972425.76
Minimum 416381222.15
Maximum 824333705.24
Spread ( max - min ) 407952483.09
Range [ ( max - min ) / 2 * 100% ] 33.83%
DTPS
Sample Data ea_es Damage Taken Per Second
Count 7665
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ea_es Healing Per Second
Count 7665
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ea_es Healing Per Second (Effective)
Count 7665
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ea_es Heal
Count 7665
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ea_es Healing Taken Per Second
Count 7665
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ea_es Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ea_esTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ea_es Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.99 totem_mastery,if=buff.resonance_totem.remains<2
9 1.98 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.96 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.87 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.03 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 50.05 earthquake
J 1.64 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.69 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.49 lava_beam
M 36.03 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.83 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.04 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.78 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.23 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.79 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.27 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.03 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 55.67 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.10 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.75 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.19 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.82 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.12 lightning_bolt
e 0.14 flame_shock,moving=1,target_if=refreshable
f 0.38 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRWVVVPWWWTWWWILLIILLIIMSWWWXXbbbfWbXXScWXcWWcIIMIIMMIMIMSWWWXXbbbTWWXSddWbbFIIMIMIISVWWdXcWcWTScccQHMMIIMIIMSW8WXAXdddWXSddWWIIFMIMIMIMSWWWdddTWWXSXcXWMIIIMMIISWcRWXXcccWSWPTWWWWILILFLILLSW97WWTddXWQWSWWXIMIMIIMIMS8WWXAXXdddWdSWTdMMIIFMIMIMSWWWTbbbWbQSXddIMIMIMIMSWWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.962 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.998 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.033 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.810 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.588 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.367 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.148 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.925 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.925 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.961 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.997 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.033 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.811 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.588 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.676 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:15.741 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.540 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.608 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.674 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.473 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.273 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.338 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.425 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.240 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.056 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.142 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.228 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.045 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.132 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.948 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.766 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.581 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.666 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.752 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.568 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, movement, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.384 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.469 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.555 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.373 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.189 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.309 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.326 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:41.081 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:41.836 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:42.754 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:43.506 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:44.427 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:45.347 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.100 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.854 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:47.790 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:48.547 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:49.301 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:50.238 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:51.220 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:51.975 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:52.956 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:54.203 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:55.864 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:57.524 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:58.770 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:00.017 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:01.645 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:02.399 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:03.154 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:04.117 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:05.080 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:06.063 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:06.817 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:07.799 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:08.780 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:09.535 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:10.517 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:11.498 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:12.481 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:13.236 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:14.219 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:15.880 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:17.102 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:18.323 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:19.543 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:20.765 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:21.986 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.025 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.064 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.101 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.485 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.544 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.603 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.016 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.429 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.489 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.900 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.960 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.371 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.755 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:38.794 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:40.176 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:41.495 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:42.814 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:44.162 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:45.173 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:46.184 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:47.529 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.874 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.885 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.895 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.306 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.365 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.427 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.839 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.252 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:58.636 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:59.391 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:00.775 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.813 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.813 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:02.852 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.264 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:05.675 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:07.087 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:08.498 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:09.558 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:10.942 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:12.261 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:13.582 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:14.573 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:15.563 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.573 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.584 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.596 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.606 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.616 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.627 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.684 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.744 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.804 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.215 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.627 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.686 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.746 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.157 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.541 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.924 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.308 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.344 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.382 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.792 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.852 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.265 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.323 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.734 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.794 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.206 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.617 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.678 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.738 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.799 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.210 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.622 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.682 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.741 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.152 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.564 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.977 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.035 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.418 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.456 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.493 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.875 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.258 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:08.240 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:08.993 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:10.129 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.111 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.111 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.866 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:12.802 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:13.739 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:14.676 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:15.614 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:16.368 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:17.305 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:18.059 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:18.995 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:19.748 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:21.331 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom ascendance, lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:22.555 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:24.182 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:25.809 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:27.436 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.476 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.515 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.515 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:30.554 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:31.938 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.999 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:34.412 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:35.823 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:36.881 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:37.940 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:38.999 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:40.060 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:41.470 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:42.529 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:43.941 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:45.001 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:46.059 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:47.469 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:48.529 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:49.941 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:50.999 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:52.059 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:53.469 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:54.529 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.939 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.351 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.105 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.450 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.772 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.766 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.766 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.757 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.747 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.066 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:06.385 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:07.706 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:09.026 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:10.411 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:11.794 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:12.785 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.797 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.144 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.491 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.836 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:18.828 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:19.819 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:20.812 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:21.804 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:22.842 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:23.881 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:24.943 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.000 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:27.411 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.420 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:29.431 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:30.776 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.786 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.006 Waiting     0.800 sec 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom movement, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.806 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.152 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.499 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.847 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.258 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.318 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.728 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.767 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:44.152 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:45.535 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:46.574 aoe M chain_lightning Fluffy_Pillow_Pack_Beast6 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.958 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:48.996 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.379 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.437 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.850 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.911 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.323 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.736 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.747 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.092 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Spell Speed 39.30% 18.38% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ea_es"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:5:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ede_crit : 2109597 dps, 972434 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2109597.0 2109597.0 2530.7 / 0.120% 439012.3 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ede_crit 2109597
Chain Lightning 201022 (437074) 9.6% (20.8%) 44.6 6.04sec 2951321 2363137 Direct 175.5 243927 685486 344635 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.56 175.50 0.00 0.00 1.2489 0.0000 60482864.15 60482864.15 0.00 2363136.99 2363136.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.48 77.19% 243927.01 147181 576656 244490.67 165990 311839 33046151 33046151 0.00
crit 40.03 22.81% 685485.55 415051 1626170 686385.11 458885 971858 27436713 27436713 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 236052 11.2% 53.8 8.99sec 1321448 0 Direct 238.3 210799 592751 298141 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.76 238.28 0.00 0.00 0.0000 0.0000 71042251.48 71042251.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.79 77.13% 210799.06 123632 484391 211106.43 136263 323278 38743732 38743732 0.00
crit 54.49 22.87% 592750.76 348643 1365983 593506.05 382363 951059 32298520 32298520 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67448 3.2% 10.0 29.94sec 2018447 2121352 Direct 10.0 1416968 3990710 2018449 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9516 0.0000 20248302.17 20248302.17 0.00 2121351.72 2121351.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.69 76.63% 1416967.71 102259 1669384 1419229.33 870050 1635952 10892411 10892411 0.00
crit 2.34 23.37% 3990710.05 288371 4707662 3667498.26 0 4707662 9355891 9355891 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (774549) 0.0% (36.7%) 50.5 5.58sec 4598857 4701778

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.49 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00 4701778.35 4701778.35
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 573485 27.2% 299.5 0.93sec 574118 0 Direct 1536.3 79642 224653 111916 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.48 1536.27 0.00 0.00 0.0000 0.0000 171935442.69 171935442.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1194.34 77.74% 79642.07 68550 89526 79673.00 75647 83705 95119981 95119981 0.00
crit 341.93 22.26% 224652.84 193310 252463 224736.38 212549 237275 76815461 76815461 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 201064 9.5% 76.8 4.16sec 785203 0 Direct 76.8 558823 1576034 785200 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.77 76.77 0.00 0.00 0.0000 0.0000 60280688.19 60280688.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.69 77.75% 558823.15 536592 598966 558963.37 542699 581343 33353618 33353618 0.00
crit 17.09 22.25% 1576034.36 1513190 1689085 1576353.03 1518394 1662025 26927071 26927071 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast3
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57591 (88066) 2.7% (4.2%) 20.0 15.20sec 1318492 998595 Direct 20.0 608005 1714192 862342 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.3204 0.0000 17272476.86 17272476.86 0.00 998594.83 998594.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 77.01% 608004.95 521261 680768 608103.86 563539 647330 9379317 9379317 0.00
crit 4.60 22.99% 1714191.97 1469956 1919766 1702196.75 0 1919766 7893160 7893160 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30475 1.4% 12.6 23.51sec 723525 0 Direct 12.6 510648 1440789 723491 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.63 12.63 0.00 0.00 0.0000 0.0000 9138359.08 9138359.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.74 77.11% 510648.27 437859 571845 510752.86 461362 564211 4973476 4973476 0.00
crit 2.89 22.89% 1440788.92 1234763 1612604 1375814.94 0 1612604 4164883 4164883 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 87502 4.1% 26.4 11.23sec 991576 1030914 Direct 26.4 92538 261372 131755 23.2%  
Periodic 316.0 50702 143007 71922 23.0% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.43 26.43 315.99 315.99 0.9619 1.2635 26208924.00 26208924.00 0.00 61717.58 1030913.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 76.78% 92537.92 77837 101655 92406.85 83917 98262 1877883 1877883 0.00
crit 6.14 23.22% 261371.85 219500 286667 259948.31 0 286667 1604458 1604458 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.3 77.01% 50701.84 30 55911 50669.08 46426 53082 12337784 12337784 0.00
crit 72.6 22.99% 143006.78 105 157670 142914.72 130503 150197 10388798 10388798 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65822 (148761) 3.1% (7.0%) 7.6 28.51sec 5815540 4962259 Direct 36.4 381549 1071478 534774 22.2%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 36.40 0.00 0.00 1.1720 0.0000 19463779.33 19463779.33 0.00 4962259.03 4962259.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 77.79% 381548.54 175131 1004613 382589.21 229273 627374 10802491 10802491 0.00
crit 8.08 22.21% 1071477.76 493870 2833009 1068891.18 0 2537991 8661288 8661288 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82938 3.9% 11.2 40.28sec 2195259 0 Direct 54.9 317587 894999 446338 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 54.93 0.00 0.00 0.0000 0.0000 24516722.50 24516722.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.68 77.70% 317587.47 147109 843868 318458.72 185091 682074 13553854 13553854 0.00
crit 12.25 22.30% 894999.29 414847 2379709 897143.90 0 2227208 10962868 10962868 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 165000 (268016) 7.8% (12.7%) 57.6 5.12sec 1391484 1227207 Direct 57.6 267258 856708 856673 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.62 57.62 0.00 0.00 1.1339 0.0000 49358668.31 49358668.31 0.00 1227206.85 1227206.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 267258.40 227021 296490 847.21 0 296490 919 919 0.00
crit 57.61 99.99% 856708.33 706308 1188126 857209.89 805864 914782 49357749 49357749 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 84427 4.0% 36.6 8.04sec 690507 0 Direct 36.6 221191 690544 690517 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.58 36.58 0.00 0.00 0.0000 0.0000 25256859.50 25256859.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 221191.36 190698 249052 468.25 0 249052 468 468 0.00
crit 36.58 99.99% 690544.07 569500 957992 690937.29 642873 749387 25256391 25256391 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18590 0.9% 43.1 6.38sec 128884 0 Direct 100.0 44784 91328 55562 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.12 100.03 0.00 0.00 0.0000 0.0000 5557895.82 5557895.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.87 76.84% 44784.43 42943 47934 44790.31 43001 47626 3442474 3442474 0.00
crit 23.16 23.16% 91327.76 87603 97785 91352.00 87603 97785 2115422 2115422 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 50126 (97623) 2.4% (4.6%) 41.2 7.10sec 712493 587422 Direct 41.2 226479 642213 365908 33.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.20 41.20 0.00 0.00 1.2129 0.0000 15076016.58 15076016.58 0.00 587422.26 587422.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.38 66.46% 226478.67 154272 604437 227514.08 172918 365085 6201098 6201098 0.00
crit 13.82 33.54% 642212.79 435046 1704513 644533.15 435046 1456849 8874919 8874919 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 47497 2.3% 46.3 8.43sec 308449 0 Direct 46.3 191037 540720 308437 33.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.29 46.29 0.00 0.00 0.0000 0.0000 14278061.24 14278061.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.75 66.42% 191036.80 129588 507727 191458.91 143746 328049 5873917 5873917 0.00
crit 15.54 33.58% 540719.83 365439 1431791 542587.65 373608 1135951 8404144 8404144 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (60070) 0.0% (2.8%) 3.0 120.34sec 5988602 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 58.02 0.00 0.0000 1.0000 0.00 0.00 0.00 308263.14 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19337 0.9% 38.0 6.88sec 151355 0 Direct 38.0 121869 248614 151357 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.03 38.03 0.00 0.00 0.0000 0.0000 5755819.12 5755819.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.18 76.74% 121869.49 121869 121869 121869.49 121869 121869 3556387 3556387 0.00
crit 8.85 23.26% 248613.77 248614 248614 248580.87 0 248614 2199433 2199433 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40733 1.9% 99.2 2.61sec 122322 0 Direct 99.2 98655 201256 122324 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.15 99.15 0.00 0.00 0.0000 0.0000 12128375.06 12128375.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.28 76.93% 98654.92 98655 98655 98654.92 98655 98655 7525342 7525342 0.00
crit 22.87 23.07% 201256.04 201256 201256 201256.04 201256 201256 4603033 4603033 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143236 / 55366
Fire Blast 143236 2.6% 63.2 4.26sec 260961 145821 Direct 63.2 212283 424490 260962 22.9%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.22 63.22 0.00 0.00 1.7896 0.0000 16496972.66 16496972.66 0.00 145820.57 145820.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.71 77.06% 212282.62 199011 222144 212275.56 207485 219732 10341120 10341120 0.00
crit 14.50 22.94% 424490.25 398022 444288 424455.45 412851 441441 6155853 6155853 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185227 / 25122
Lightning Blast 185227 1.2% 40.0 7.04sec 188608 201026 Direct 40.0 153754 307627 188604 22.7%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.96 39.96 0.00 0.00 0.9382 0.0000 7537276.56 7537276.56 0.00 201026.21 201026.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.91 77.35% 153754.49 147415 164551 153793.33 149105 161357 4752642 4752642 0.00
crit 9.05 22.65% 307626.93 294831 329102 307666.80 0 329102 2784635 2784635 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ede_crit
Ascendance 2.0 181.72sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0332 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.15sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8130 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5092 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.51% 13.51% 0.0(0.0) 1.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.07% 32.07% 3.1(3.1) 8.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.7sec 25.8sec 31.51% 31.51% 1.3(1.3) 9.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.8sec 31.52% 31.52% 1.3(1.3) 9.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.3sec 25.4sec 30.79% 30.79% 1.6(1.6) 9.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.7 3.8sec 2.8sec 73.70% 68.24% 28.7(28.7) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.91%
  • elemental_focus_2:52.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 24.3 7.1 11.9sec 9.1sec 25.58% 42.77% 7.2(7.2) 1.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.58%

Trigger Attempt Success

  • trigger_pct:99.80%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.80% 29.80% 4.3(4.3) 12.6

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 86.7sec 86.7sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.98%
Nefarious Pact 3.5 0.0 69.3sec 69.3sec 13.58% 13.58% 0.0(0.0) 3.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.58%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.6sec 0.0sec 39.80% 39.80% 0.0(0.0) 1.7

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.7sec 31.3sec 31.36% 38.63% 2.5(6.1) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.94%
  • power_of_the_maelstrom_2:7.11%
  • power_of_the_maelstrom_3:18.30%

Trigger Attempt Success

  • trigger_pct:15.14%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.5sec 44.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:9.98%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.32% 9.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.13%
  • stormkeeper_2:3.61%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 31.5 9.1sec
Lava Surge: Wasted 7.3 30.6sec
Lava Surge: During Lava Burst 4.4 53.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6240.00116.64915.9440.12422.582
Fire Elemental0.3270.0011.2490.0970.0001.249
Ascendance1.8820.0019.0651.6610.0009.065
Lava Burst2.9170.00134.32544.1959.126103.291
Elemental Blast2.1210.00120.11735.59619.36362.826

Resources

Resource Usage Type Count Total Average RPE APR
ede_crit
earth_shock Maelstrom 79.0 9367.1 118.6 933.8 2161.6
earthquake Maelstrom 397.5 19876.5 50.0 393.6 11683.0
flame_shock Maelstrom 208.1 3940.2 18.9 149.1 6651.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 453.62 5385.28 (16.05%) 11.87 58.14 1.07%
Lava Burst Overload Maelstrom 287.96 2522.86 (7.52%) 8.76 68.76 2.65%
Lava Beam Maelstrom 59.54 1676.88 (5.00%) 28.16 42.38 2.46%
Lava Beam Overload Maelstrom 87.92 1653.28 (4.93%) 18.80 76.38 4.42%
Chain Lightning Maelstrom 350.87 8142.34 (24.27%) 23.21 147.97 1.78%
Chain Lightning Overload Maelstrom 423.27 7101.01 (21.16%) 16.78 402.69 5.37%
Lightning Bolt Maelstrom 324.36 2585.43 (7.71%) 7.97 9.44 0.36%
Lightning Bolt Overload Maelstrom 364.43 2165.17 (6.45%) 5.94 21.42 0.98%
Resonance Totem Maelstrom 2351.03 2321.66 (6.92%) 0.99 29.37 1.25%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.51 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ede_crit Fight Length
Count 7558
Mean 300.00
Minimum 240.00
Maximum 360.01
Spread ( max - min ) 120.01
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.5596
5th Percentile 246.47
95th Percentile 353.50
( 95th Percentile - 5th Percentile ) 107.03
Mean Distribution
Standard Deviation 0.3975
95.00% Confidence Intervall ( 299.22 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50980
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1020
DPS
Sample Data ede_crit Damage Per Second
Count 7558
Mean 2109597.01
Minimum 1747646.38
Maximum 2585460.82
Spread ( max - min ) 837814.44
Range [ ( max - min ) / 2 * 100% ] 19.86%
Standard Deviation 112253.7612
5th Percentile 1932317.24
95th Percentile 2299148.56
( 95th Percentile - 5th Percentile ) 366831.32
Mean Distribution
Standard Deviation 1291.2117
95.00% Confidence Intervall ( 2107066.28 - 2112127.74 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10877
0.1 Scale Factor Error with Delta=300 107568589
0.05 Scale Factor Error with Delta=300 430274356
0.01 Scale Factor Error with Delta=300 10756858891
Priority Target DPS
Sample Data ede_crit Priority Target Damage Per Second
Count 7558
Mean 972433.61
Minimum 836353.07
Maximum 1154406.37
Spread ( max - min ) 318053.29
Range [ ( max - min ) / 2 * 100% ] 16.35%
Standard Deviation 42306.9887
5th Percentile 906003.43
95th Percentile 1044384.98
( 95th Percentile - 5th Percentile ) 138381.55
Mean Distribution
Standard Deviation 486.6410
95.00% Confidence Intervall ( 971479.81 - 973387.41 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7272
0.1 Scale Factor Error with Delta=300 15279457
0.05 Scale Factor Error with Delta=300 61117825
0.01 Scale Factor Error with Delta=300 1527945616
DPS(e)
Sample Data ede_crit Damage Per Second (Effective)
Count 7558
Mean 2109597.01
Minimum 1747646.38
Maximum 2585460.82
Spread ( max - min ) 837814.44
Range [ ( max - min ) / 2 * 100% ] 19.86%
Damage
Sample Data ede_crit Damage
Count 7558
Mean 608001506.08
Minimum 420843462.04
Maximum 826719864.66
Spread ( max - min ) 405876402.62
Range [ ( max - min ) / 2 * 100% ] 33.38%
DTPS
Sample Data ede_crit Damage Taken Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ede_crit Healing Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ede_crit Healing Per Second (Effective)
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ede_crit Heal
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ede_crit Healing Taken Per Second
Count 7558
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ede_crit Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ede_critTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ede_crit Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.96 totem_mastery,if=buff.resonance_totem.remains<2
9 1.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.92 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.83 stormkeeper
G 0.14 ascendance
0.00 liquid_magma_totem
H 1.98 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.30 earthquake
J 1.60 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.67 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.38 lava_beam
M 35.51 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.81 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.97 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.75 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.70 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 1.98 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.83 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.88 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.73 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.21 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.65 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.72 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWWTWWLILILIILIMMHHHJJSWWWdTdddXdWdQSHMIIMMIIWWXSXWcWTWWXcdSfWFMMIMIMIMSWWXcWcTWWdSdWQWIMIMIIIMMSW8WAddTddWdSWQbIFMIMIMIMIMSWWbbbTddWdWSWTWQMMIMMIIMKRWWccccTcWPSWWWILFIILILISVWW97WWbQbbTSWWccccIIMIIMMIIS8WWWAccYQWcSWWddIMFIIMIMSQWWVTbbdWdSdWTWMIMMIIMISQWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.960 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.047 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.135 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.951 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.766 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.582 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.400 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.400 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.487 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.573 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.390 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.477 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.294 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.380 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.464 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.551 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.367 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.454 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.271 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.357 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.174 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.992 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.078 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.878 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.944 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.009 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.808 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.607 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.406 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.203 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.019 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.106 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.923 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.739 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.825 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.913 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.730 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.815 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.902 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.989 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.806 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.892 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.978 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.391 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.450 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.862 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.921 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.266 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.277 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.287 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.634 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.982 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.992 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.001 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.994 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.315 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.353 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.738 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.775 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.837 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.249 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.660 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.719 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.779 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.192 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.250 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.664 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.075 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.134 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom movement, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.193 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.604 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.662 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.722 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.781 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.840 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.899 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.959 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.371 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.431 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.842 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.252 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:28.635 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:30.018 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:31.057 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.440 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:33.478 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:34.889 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:35.947 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:37.006 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.417 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.828 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.239 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.584 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:43.593 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.603 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.612 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.622 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.968 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.979 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.326 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.336 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.396 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.458 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.870 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:56.252 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:57.636 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:59.020 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:59.774 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:01.159 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.159 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.571 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.983 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.041 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.452 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.865 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.279 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.690 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.101 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.160 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:14.219 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:15.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.694 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.752 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.814 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:19.568 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:20.323 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:21.079 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:21.835 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:22.590 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:23.572 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:24.327 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:25.309 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:26.291 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:27.046 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:27.984 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:28.920 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:29.857 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:30.794 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:31.548 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:33.132 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:34.715 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:36.298 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:37.924 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:39.146 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:40.529 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:41.568 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.607 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.019 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.079 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.490 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.901 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.960 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.371 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.782 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.843 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.903 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.316 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.727 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.736 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.081 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.426 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.772 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.118 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.465 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.812 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.823 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.233 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.644 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.644 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.054 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.467 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.879 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.289 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.327 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.710 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.786 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:19.824 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, elemental_blast_critical_strike, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:20.861 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom ascendance, elemental_blast_critical_strike, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.272 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.330 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.742 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.801 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.212 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.222 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.232 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.243 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.254 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.254 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:32.265 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:33.611 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:34.957 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:35.967 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:37.314 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:38.276 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:39.029 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:40.170 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:40.924 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:41.842 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:42.760 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:43.698 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:44.633 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:45.570 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:46.324 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:47.078 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:48.013 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:48.767 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:49.955 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:51.537 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:53.198 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:54.445 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:55.691 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:57.353 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.107 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.165 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.575 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.633 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.633 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.045 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.457 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:05.517 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:06.577 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.987 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.398 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.809 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:11.866 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.279 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:14.692 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:16.104 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:17.163 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:18.575 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:19.843 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:20.901 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:21.961 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:23.021 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:24.082 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:25.141 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.553 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:27.591 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:28.628 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:30.011 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:31.052 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:32.090 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.502 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.914 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.327 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.740 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.150 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.561 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.972 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.031 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.091 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.504 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.916 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.975 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.387 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.799 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.859 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.920 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.331 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.388 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.800 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.810 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.822 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Spell Speed 39.30% 18.38% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ede_crit"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:5:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

edi_cl : 2115345 dps, 966896 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2115344.9 2115344.9 2537.0 / 0.120% 447024.1 / 21.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
edi_cl 2115345
Chain Lightning 207854 (451836) 9.9% (21.5%) 44.7 6.02sec 3043834 2436272 Direct 175.8 253867 701043 355633 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.67 175.84 0.00 0.00 1.2494 0.0000 62534574.94 62534574.94 0.00 2436271.84 2436271.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.82 77.24% 253867.17 153314 600684 254366.71 171862 314790 34481491 34481491 0.00
crit 40.02 22.76% 701042.66 424372 1662692 702072.52 469486 1102497 28053083 28053083 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 243981 11.6% 53.9 9.02sec 1362874 0 Direct 238.5 219555 605078 307844 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.87 238.50 0.00 0.00 0.0000 0.0000 73424011.55 73424011.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.87 77.10% 219555.21 128784 504574 219726.86 140597 325917 40371258 40371258 0.00
crit 54.62 22.90% 605077.51 356473 1396661 606023.22 387469 940023 33052754 33052754 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67068 3.2% 10.0 29.69sec 2003715 2105526 Direct 10.0 1417879 3924074 2003804 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.05 10.05 0.00 0.00 0.9517 0.0000 20137250.30 20137250.30 0.00 2105525.96 2105525.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.70 76.62% 1417878.83 102259 1669384 1419930.76 951930 1669384 10918526 10918526 0.00
crit 2.35 23.38% 3924073.56 303301 4620854 3607235.64 0 4620854 9218724 9218724 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (768464) 0.0% (36.4%) 50.5 5.60sec 4564823 4666873

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.47 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00 4666873.24 4666873.24
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 568838 26.9% 299.3 0.94sec 569774 0 Direct 1536.8 79625 220475 110962 22.2%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.29 1536.82 0.00 0.00 0.0000 0.0000 170527607.25 170527607.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1194.89 77.75% 79625.05 68550 89526 79658.07 75595 84522 95142598 95142598 0.00
crit 341.92 22.25% 220475.49 189746 247808 220565.49 210080 234094 75385009 75385009 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199626 9.4% 76.8 4.16sec 778804 0 Direct 76.8 558740 1546488 778789 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.84 76.84 0.00 0.00 0.0000 0.0000 59843256.53 59843256.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.72 77.72% 558739.89 536592 598966 558874.79 543610 583349 33368434 33368434 0.00
crit 17.12 22.28% 1546487.58 1485287 1657939 1546702.74 1485287 1628531 26474823 26474823 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear1
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57010 (87261) 2.7% (4.1%) 20.0 15.23sec 1307872 990500 Direct 20.0 607889 1682988 854406 22.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.01 20.01 0.00 0.00 1.3204 0.0000 17094879.09 17094879.09 0.00 990500.05 990500.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.42 77.07% 607888.97 521261 680768 607974.09 567054 657137 9373800 9373800 0.00
crit 4.59 22.93% 1682987.64 1442850 1884366 1670203.00 0 1884366 7721080 7721080 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30251 1.4% 12.6 23.19sec 718715 0 Direct 12.6 510601 1414335 718742 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.62 12.62 0.00 0.00 0.0000 0.0000 9073141.73 9073141.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.72 76.97% 510601.38 437859 571845 510654.61 450584 556958 4961532 4961532 0.00
crit 2.91 23.03% 1414334.56 1211994 1582868 1349370.09 0 1582868 4111610 4111610 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86901 4.1% 26.5 11.21sec 982893 1022241 Direct 26.5 92554 256467 130625 23.2%  
Periodic 316.5 50716 140367 71313 23.0% 133.3%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.48 26.48 316.47 316.47 0.9615 1.2636 26027280.58 26027280.58 0.00 61190.41 1022241.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.33 76.78% 92554.45 77837 101655 92423.34 84256 98805 1881653 1881653 0.00
crit 6.15 23.22% 256467.02 215453 281381 255284.28 0 281381 1577259 1577259 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.8 77.03% 50715.90 32 55911 50686.84 45930 53139 12362679 12362679 0.00
crit 72.7 22.97% 140366.71 86 154763 140283.69 124665 147079 10205690 10205690 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 68111 (153481) 3.2% (7.2%) 7.6 28.47sec 5994317 5119045 Direct 36.4 397600 1096090 552213 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.57 36.45 0.00 0.00 1.1710 0.0000 20126537.92 20126537.92 0.00 5119045.41 5119045.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.38 77.86% 397599.64 182428 1046472 398558.54 241277 623527 11283585 11283585 0.00
crit 8.07 22.14% 1096090.35 504961 2896634 1092698.09 0 2654226 8842953 8842953 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 85370 4.0% 11.2 40.09sec 2250346 0 Direct 55.2 328611 906224 457388 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 55.19 0.00 0.00 0.0000 0.0000 25238442.50 25238442.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.89 77.71% 328611.43 153238 879030 329473.26 185744 696608 14090547 14090547 0.00
crit 12.30 22.29% 906224.40 424164 2433154 908649.20 0 2129798 11147895 11147895 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162055 (263893) 7.6% (12.5%) 57.7 5.10sec 1367727 1206438 Direct 57.7 269250 839990 839962 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.71 57.71 0.00 0.00 1.1337 0.0000 48473060.14 48473060.14 0.00 1206438.01 1206438.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 269249.88 227021 296490 760.69 0 296490 761 761 0.00
crit 57.71 100.00% 839990.33 692614 1165090 840536.41 798151 909261 48472299 48472299 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83183 3.9% 36.7 7.98sec 678282 0 Direct 36.7 222470 678305 678285 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.68 36.68 0.00 0.00 0.0000 0.0000 24879726.73 24879726.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 222469.90 190698 249052 371.40 0 249052 371 371 0.00
crit 36.68 100.00% 678305.36 559584 941311 678773.23 630812 740349 24879355 24879355 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18655 0.9% 43.3 6.35sec 128913 0 Direct 100.3 44796 91331 55599 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.26 100.31 0.00 0.00 0.0000 0.0000 5577213.78 5577213.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.03 76.79% 44795.73 42943 47934 44800.33 43047 47531 3450505 3450505 0.00
crit 23.29 23.21% 91330.95 87603 97785 91342.24 0 97158 2126709 2126709 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49332 (96082) 2.3% (4.6%) 41.0 7.15sec 704940 581159 Direct 41.0 226874 631263 361974 33.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.2130 0.0000 14841131.06 14841131.06 0.00 581158.78 581158.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.30 66.59% 226874.46 154272 604437 227981.14 172318 368188 6194616 6194616 0.00
crit 13.70 33.41% 631263.26 427024 1673082 632803.76 443570 1224626 8646515 8646515 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46750 2.2% 45.9 8.50sec 306042 0 Direct 45.9 191367 533185 306064 33.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.95 45.95 0.00 0.00 0.0000 0.0000 14062219.47 14062219.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.53 66.44% 191367.26 129588 507727 191879.33 142648 319999 5842488 5842488 0.00
crit 15.42 33.56% 533184.81 358700 1405389 534477.96 358700 1042786 8219732 8219732 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59981) 0.0% (2.8%) 3.0 120.31sec 5982631 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.92 0.00 0.0000 1.0000 0.00 0.00 0.00 308313.85 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19328 0.9% 38.0 6.91sec 151274 0 Direct 38.0 121869 248614 151279 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.03 38.03 0.00 0.00 0.0000 0.0000 5752577.53 5752577.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.21 76.80% 121869.49 121869 121869 121869.49 121869 121869 3559240 3559240 0.00
crit 8.82 23.20% 248613.77 248614 248614 248581.84 0 248614 2193337 2193337 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40654 1.9% 99.0 2.61sec 122270 0 Direct 99.0 98655 201256 122270 23.0%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.01 99.01 0.00 0.00 0.0000 0.0000 12106193.68 12106193.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.22 76.98% 98654.92 98655 98655 98654.92 98655 98655 7519742 7519742 0.00
crit 22.79 23.02% 201256.04 201256 201256 201256.04 201256 201256 4586451 4586451 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143136 / 55291
Fire Blast 143136 2.6% 63.1 4.27sec 260889 145753 Direct 63.1 212255 424558 260897 22.9%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.14 63.14 0.00 0.00 1.7899 0.0000 16473047.51 16473047.51 0.00 145753.38 145753.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.68 77.09% 212255.45 199011 222144 212253.04 207647 219677 10332038 10332038 0.00
crit 14.46 22.91% 424557.52 398022 444288 424555.85 413274 444288 6141010 6141010 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 184969 / 25088
Lightning Blast 184969 1.2% 40.0 7.03sec 188340 200746 Direct 40.0 153769 307609 188334 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.96 39.96 0.00 0.00 0.9382 0.0000 7525561.04 7525561.04 0.00 200745.87 200745.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.98 77.53% 153768.69 147415 164551 153812.38 149085 161720 4763451 4763451 0.00
crit 8.98 22.47% 307609.03 294831 329102 307647.17 0 329102 2762110 2762110 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
edi_cl
Ascendance 2.0 181.68sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0333 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.16sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8135 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.59sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5094 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.2 3.1 35.6sec 25.1sec 31.98% 31.98% 3.1(3.1) 7.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:31.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 68.9sec 68.9sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.7sec 25.8sec 31.52% 31.52% 1.3(1.3) 9.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.7sec 31.62% 31.62% 1.3(1.3) 9.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.6sec 25.6sec 30.53% 30.53% 1.6(1.6) 8.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.7 3.8sec 2.8sec 73.73% 68.26% 28.7(28.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.94%
  • elemental_focus_2:52.78%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.5 7.2 11.8sec 9.1sec 25.66% 42.94% 7.2(7.2) 1.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.66%

Trigger Attempt Success

  • trigger_pct:99.82%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.79% 29.79% 4.2(4.2) 12.6

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 86.8sec 86.8sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.35%
Nefarious Pact 3.4 0.0 69.2sec 69.2sec 13.50% 13.50% 0.0(0.0) 3.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.50%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.4sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.4 45.8sec 31.6sec 31.44% 38.59% 2.4(6.0) 2.1

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.93%
  • power_of_the_maelstrom_2:7.14%
  • power_of_the_maelstrom_3:18.37%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.2sec 44.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.06%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.32% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.11%
  • stormkeeper_2:3.60%
  • stormkeeper_3:3.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.7 9.1sec
Lava Surge: Wasted 7.3 30.5sec
Lava Surge: During Lava Burst 4.4 53.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6310.00116.65216.0180.02519.560
Fire Elemental0.3270.0011.2480.0960.0001.248
Ascendance1.8680.0019.0461.6590.0009.046
Lava Burst2.9150.00137.65644.3697.98896.143
Elemental Blast2.1360.00120.81835.75917.53764.372

Resources

Resource Usage Type Count Total Average RPE APR
edi_cl
earth_shock Maelstrom 78.3 9286.4 118.7 924.0 2168.5
earthquake Maelstrom 393.0 19650.6 50.0 389.4 11723.4
flame_shock Maelstrom 206.2 3904.8 18.9 147.5 6665.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 449.40 5335.30 (16.07%) 11.87 57.50 1.07%
Lava Burst Overload Maelstrom 285.65 2501.44 (7.53%) 8.76 69.42 2.70%
Lava Beam Maelstrom 58.92 1659.63 (5.00%) 28.17 43.14 2.53%
Lava Beam Overload Maelstrom 87.33 1639.99 (4.94%) 18.78 79.01 4.60%
Chain Lightning Maelstrom 347.86 8068.77 (24.30%) 23.20 147.52 1.80%
Chain Lightning Overload Maelstrom 419.59 7030.48 (21.17%) 16.76 399.38 5.38%
Lightning Bolt Maelstrom 319.26 2544.78 (7.66%) 7.97 9.32 0.37%
Lightning Bolt Overload Maelstrom 357.78 2125.60 (6.40%) 5.94 21.08 0.98%
Resonance Totem Maelstrom 2325.59 2296.06 (6.92%) 0.99 29.53 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.06
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.18 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data edi_cl Fight Length
Count 7787
Mean 300.01
Minimum 239.99
Maximum 360.01
Spread ( max - min ) 120.02
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.0123
5th Percentile 245.91
95th Percentile 354.09
( 95th Percentile - 5th Percentile ) 108.18
Mean Distribution
Standard Deviation 0.3968
95.00% Confidence Intervall ( 299.23 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 524
0.1% Error 52322
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1047
DPS
Sample Data edi_cl Damage Per Second
Count 7787
Mean 2115344.91
Minimum 1744744.33
Maximum 2671833.09
Spread ( max - min ) 927088.75
Range [ ( max - min ) / 2 * 100% ] 21.91%
Standard Deviation 114223.2101
5th Percentile 1939333.67
95th Percentile 2309153.04
( 95th Percentile - 5th Percentile ) 369819.38
Mean Distribution
Standard Deviation 1294.4023
95.00% Confidence Intervall ( 2112807.93 - 2117881.89 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11201
0.1 Scale Factor Error with Delta=300 111376199
0.05 Scale Factor Error with Delta=300 445504795
0.01 Scale Factor Error with Delta=300 11137619868
Priority Target DPS
Sample Data edi_cl Priority Target Damage Per Second
Count 7787
Mean 966896.19
Minimum 834122.91
Maximum 1175170.50
Spread ( max - min ) 341047.59
Range [ ( max - min ) / 2 * 100% ] 17.64%
Standard Deviation 42310.5810
5th Percentile 900939.85
95th Percentile 1039309.11
( 95th Percentile - 5th Percentile ) 138369.26
Mean Distribution
Standard Deviation 479.4727
95.00% Confidence Intervall ( 965956.44 - 967835.94 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7356
0.1 Scale Factor Error with Delta=300 15282052
0.05 Scale Factor Error with Delta=300 61128205
0.01 Scale Factor Error with Delta=300 1528205108
DPS(e)
Sample Data edi_cl Damage Per Second (Effective)
Count 7787
Mean 2115344.91
Minimum 1744744.33
Maximum 2671833.09
Spread ( max - min ) 927088.75
Range [ ( max - min ) / 2 * 100% ] 21.91%
Damage
Sample Data edi_cl Damage
Count 7787
Mean 609719104.78
Minimum 424652223.66
Maximum 833047475.19
Spread ( max - min ) 408395251.52
Range [ ( max - min ) / 2 * 100% ] 33.49%
DTPS
Sample Data edi_cl Damage Taken Per Second
Count 7787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data edi_cl Healing Per Second
Count 7787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data edi_cl Healing Per Second (Effective)
Count 7787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data edi_cl Heal
Count 7787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data edi_cl Healing Taken Per Second
Count 7787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data edi_cl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data edi_clTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data edi_cl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.02 totem_mastery,if=buff.resonance_totem.remains<2
9 2.01 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.96 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.07 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 50.77 earthquake
J 1.70 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.72 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.61 lava_beam
M 36.62 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.86 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.11 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.82 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.52 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.95 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.08 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 56.53 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.41 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.78 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.49 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.99 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.36 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.38 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdWVVPWWWTWWLIILILIILLISWWXXbWbYbdWIJJIKMMIJIMMIIIMIMIKMMIFMIMMIMIKQWWMMIIIMMISWXXWbbbcTWQSWWXMIMMIIIMISW8WXAXddWdXSddWFIMIMIMMIMSWWXddWddTQWcXcSHHJJMIIMMIMIQSWWXXWcccWTSWRWGLFILLIILLSWWWTWbXXd97SWdXMIIMMIIIMS8WWXAXWdddWWSTWbbMIFIIMIMIQSWWdddTcWWXSXbbIMMIIIMIQSWWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.028 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.092 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.893 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.692 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.491 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.290 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.106 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.106 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.192 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.279 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.366 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.183 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.269 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.084 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.170 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.986 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.802 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.889 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.707 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.793 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.612 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.427 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.513 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.600 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.417 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.503 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.589 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.677 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.494 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.310 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:31.065 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:31.820 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:32.574 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:33.329 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.083 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.835 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:35.588 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:36.342 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:37.097 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:37.851 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:38.606 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:39.364 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.120 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.875 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:41.629 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:42.383 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:43.550 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:45.102 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:46.655 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:47.845 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:49.032 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:50.222 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.693 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.105 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.164 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.576 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.988 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.399 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.458 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.519 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.578 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.637 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.697 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.756 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.814 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.228 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.289 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.699 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.758 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.004 Waiting     0.800 sec 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom movement, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.804 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.215 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.628 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.039 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.099 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.156 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.216 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.627 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.038 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.098 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:26.510 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.923 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.983 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.042 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.427 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.812 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.197 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:35.581 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:36.965 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:38.002 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:39.042 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:40.102 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:41.513 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:42.574 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:43.986 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.044 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.455 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.514 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.926 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.338 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.396 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.456 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.514 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.925 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.985 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.396 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.455 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.209 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.620 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.679 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.679 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.739 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.150 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.560 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.973 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.384 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.442 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.850 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.262 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.673 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:15.056 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:16.095 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:17.133 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:18.172 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:19.209 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:20.247 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.308 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.366 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.777 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.836 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.247 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.659 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.670 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.680 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:30.434 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:31.371 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:32.308 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:33.063 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:33.999 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:34.936 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:35.691 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:36.445 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:37.381 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:38.320 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.073 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.055 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.037 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:42.283 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:43.471 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:44.659 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:45.848 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:47.433 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:48.621 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:49.810 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:51.128 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:52.450 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.490 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.872 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.913 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.952 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.362 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.773 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.185 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.243 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.301 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.361 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.773 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.186 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.599 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.658 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.717 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.103 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.094 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.084 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.405 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.405 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.726 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.738 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom ascendance, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.749 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom ascendance, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.096 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom ascendance, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.441 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom ascendance, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.451 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.511 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.923 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.337 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.750 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom ascendance, lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.807 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom ascendance, lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.868 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.279 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.339 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.749 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.161 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.221 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.280 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.691 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.750 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.750 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:41.163 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.574 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.985 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:45.044 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.455 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:47.514 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:48.574 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:49.985 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:51.396 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:52.456 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:53.515 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:54.575 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:55.986 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:57.397 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:58.152 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.164 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.484 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.474 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.474 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.466 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.457 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:04.777 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:06.124 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.469 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:08.463 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:09.500 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:10.885 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:11.876 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:13.196 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:14.542 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.890 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.235 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.247 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.257 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.267 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:21.278 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:22.337 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:23.396 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:24.457 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.515 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.573 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:27.984 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:29.043 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:30.454 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:31.513 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:32.923 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:34.335 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:35.394 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:36.807 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:37.867 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:39.277 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:40.336 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.748 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.787 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:44.170 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:45.554 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:46.594 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:47.977 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.388 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.447 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.506 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.565 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.977 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.038 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.097 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.509 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.568 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.627 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="edi_cl"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:5:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

fs_fs : 2099058 dps, 967413 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2099058.0 2099058.0 2518.0 / 0.120% 436789.9 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fs_fs 2099058
Chain Lightning 199641 (434294) 9.6% (20.8%) 44.6 5.99sec 2927432 2343451 Direct 175.7 243477 674267 341855 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.63 175.69 0.00 0.00 1.2492 0.0000 60062759.22 60062759.22 0.00 2343451.42 2343451.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.57 77.16% 243477.08 147181 576656 244006.04 165919 313923 33009766 33009766 0.00
crit 40.12 22.84% 674266.85 407397 1596184 675409.70 450604 985466 27052993 27052993 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 234652 11.2% 54.1 8.92sec 1305331 0 Direct 239.4 210345 579602 294878 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.08 239.38 0.00 0.00 0.0000 0.0000 70589344.15 70589344.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.58 77.11% 210344.99 123632 484391 210666.04 136622 312523 38826436 38826436 0.00
crit 54.80 22.89% 579601.54 342214 1340795 580937.65 378771 965054 31762909 31762909 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast4
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67402 3.2% 10.1 30.00sec 2008140 2109392 Direct 10.1 1417090 3922285 2008372 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.08 10.08 0.00 0.00 0.9520 0.0000 20233284.30 20233284.30 0.00 2109391.61 2109391.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.70 76.40% 1417090.35 102259 1669384 1419933.13 1052627 1669384 10908847 10908847 0.00
crit 2.38 23.60% 3922285.10 311359 4620854 3635923.41 0 4620854 9324437 9324437 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (769164) 0.0% (36.7%) 50.5 5.55sec 4562271 4664338

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.55 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00 4664338.16 4664338.16
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 569908 27.2% 299.9 0.93sec 569713 0 Direct 1538.7 79655 220501 111031 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.87 1538.68 0.00 0.00 0.0000 0.0000 170842753.41 170842753.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.90 77.72% 79655.08 68550 89526 79692.70 75205 83952 95259848 95259848 0.00
crit 342.78 22.28% 220500.91 189746 247808 220603.42 207413 231929 75582906 75582906 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199256 9.5% 76.7 4.17sec 778857 0 Direct 76.7 558922 1546917 778841 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.73 76.73 0.00 0.00 0.0000 0.0000 59762125.31 59762125.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.65 77.74% 558922.09 536592 598966 559071.61 541754 581488 33339735 33339735 0.00
crit 17.08 22.26% 1546916.75 1485287 1657939 1547384.42 1490030 1628426 26422390 26422390 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 56969 (87414) 2.7% (4.2%) 20.0 15.22sec 1308994 991134 Direct 20.0 607744 1682421 853205 22.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.3207 0.0000 17086220.83 17086220.83 0.00 991134.28 991134.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.45 77.16% 607743.75 521261 680768 607827.14 552054 645161 9389861 9389861 0.00
crit 4.57 22.84% 1682421.10 1442850 1884366 1669030.44 0 1884366 7696360 7696360 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30446 1.5% 12.7 23.02sec 719132 0 Direct 12.7 510509 1413605 719078 23.1%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.69 12.69 0.00 0.00 0.0000 0.0000 9126307.58 9126307.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.76 76.90% 510508.94 437859 571845 510544.29 454825 556958 4982044 4982044 0.00
crit 2.93 23.10% 1413604.69 1211994 1582868 1352035.16 0 1582868 4144264 4144264 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 91873 4.4% 26.4 11.38sec 1043452 1084779 Direct 26.4 98153 271959 138246 23.1%  
Periodic 315.5 53780 148898 75663 23.0% 132.8%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 315.48 315.48 0.9619 1.2631 27515409.99 27515409.99 0.00 64918.87 1084778.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 76.94% 98152.56 82554 107816 98011.52 88447 103567 1991348 1991348 0.00
crit 6.08 23.06% 271958.91 228511 298435 270442.12 0 298435 1653838 1653838 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 242.9 76.99% 53780.02 33 59300 53747.17 48775 56112 13063257 13063257 0.00
crit 72.6 23.01% 148897.75 96 164142 148793.43 133866 155920 10806968 10806968 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65461 (148525) 3.1% (7.0%) 7.6 28.37sec 5804486 4960570 Direct 36.4 381317 1051752 531117 22.3%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 36.44 0.00 0.00 1.1701 0.0000 19354807.35 19354807.35 0.00 4960569.96 4960569.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.30 77.66% 381316.99 175131 1004613 382352.18 224170 606994 10790552 10790552 0.00
crit 8.14 22.34% 1051752.45 484763 2780769 1046762.00 0 2527971 8564255 8564255 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 83064 3.9% 11.3 40.46sec 2171906 0 Direct 55.6 316923 873922 441360 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 55.62 0.00 0.00 0.0000 0.0000 24551197.38 24551197.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.20 77.66% 316922.95 147109 843868 317269.21 186765 668737 13691423 13691423 0.00
crit 12.42 22.34% 873921.53 407197 2335828 876068.07 0 2335828 10859775 10859775 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 161764 (263443) 7.7% (12.5%) 57.6 5.17sec 1368056 1206434 Direct 57.6 262763 840128 840083 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.59 57.59 0.00 0.00 1.1340 0.0000 48381650.45 48381650.45 0.00 1206433.61 1206433.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 262762.63 227021 296490 1179.24 0 296490 1179 1179 0.00
crit 57.59 99.99% 840127.58 692614 1165090 840688.84 800057 894173 48380471 48380471 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83139 4.0% 36.7 8.09sec 678486 0 Direct 36.7 225467 678507 678485 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.65 36.65 0.00 0.00 0.0000 0.0000 24868194.17 24868194.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 225467.20 190698 249052 416.65 0 249052 417 417 0.00
crit 36.65 99.99% 678507.34 559584 941311 678992.29 634531 737919 24867778 24867778 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18540 0.9% 43.1 6.34sec 128364 0 Direct 99.7 44789 91334 55556 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.15 99.70 0.00 0.00 0.0000 0.0000 5538715.13 5538715.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.64 76.87% 44789.29 42943 47934 44796.84 43026 47560 3432464 3432464 0.00
crit 23.06 23.13% 91333.99 87603 97785 91356.32 87603 97785 2106251 2106251 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49594 (96639) 2.4% (4.6%) 41.1 7.10sec 706812 582370 Direct 41.1 226992 631745 362828 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.12 41.12 0.00 0.00 1.2137 0.0000 14918544.45 14918544.45 0.00 582369.91 582369.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.32 66.44% 226991.74 154272 604437 228051.62 172937 372293 6201054 6201054 0.00
crit 13.80 33.56% 631745.12 427024 1673082 633257.31 443570 1257730 8717490 8717490 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 47045 2.2% 46.2 8.40sec 306004 0 Direct 46.2 191880 533240 306011 33.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.22 46.22 0.00 0.00 0.0000 0.0000 14144626.04 14144626.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.77 66.57% 191879.80 129588 507727 192275.06 142836 349567 5903592 5903592 0.00
crit 15.45 33.43% 533239.50 358700 1405389 533990.52 385917 1110108 8241034 8241034 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59967) 0.0% (2.8%) 3.0 120.34sec 5989124 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.86 0.00 0.0000 1.0000 0.00 0.00 0.00 308581.01 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19336 0.9% 38.0 6.90sec 151254 0 Direct 38.0 121869 248614 151255 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.05 38.05 0.00 0.00 0.0000 0.0000 5754487.68 5754487.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.22 76.82% 121869.49 121869 121869 121869.49 121869 121869 3561626 3561626 0.00
crit 8.82 23.18% 248613.77 248614 248614 248580.95 0 248614 2192861 2192861 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40631 1.9% 98.8 2.60sec 122426 0 Direct 98.8 98655 201256 122426 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.84 98.84 0.00 0.00 0.0000 0.0000 12100626.77 12100626.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.94 76.83% 98654.92 98655 98655 98654.92 98655 98655 7491927 7491927 0.00
crit 22.90 23.17% 201256.04 201256 201256 201256.04 201256 201256 4608700 4608700 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143123 / 55236
Fire Blast 143123 2.6% 63.1 4.29sec 260923 145760 Direct 63.1 212297 424605 260921 22.9%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.07 63.07 0.00 0.00 1.7901 0.0000 16457184.30 16457184.30 0.00 145760.05 145760.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.63 77.10% 212296.93 199011 222144 212290.04 207485 218991 10323308 10323308 0.00
crit 14.45 22.90% 424605.16 398022 444288 424608.96 412851 444288 6133876 6133876 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 184919 / 25100
Lightning Blast 184919 1.2% 39.9 7.06sec 188474 200731 Direct 39.9 153753 307668 188465 22.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.95 39.95 0.00 0.00 0.9389 0.0000 7529204.63 7529204.63 0.00 200730.61 200730.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.94 77.44% 153753.36 147415 164551 153791.50 149006 161975 4756677 4756677 0.00
crit 9.01 22.56% 307667.71 294831 329102 307757.07 294831 329102 2772528 2772528 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
fs_fs
Ascendance 2.0 181.53sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0336 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.05sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8136 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.62sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5098 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.6sec 181.6sec 10.14% 15.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.13% 32.13% 3.1(3.1) 8.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.65% 8.65% 0.0(0.0) 3.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.65%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.8sec 25.9sec 31.47% 31.47% 1.3(1.3) 9.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.4sec 25.5sec 31.72% 31.72% 1.3(1.3) 9.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.5sec 30.66% 30.66% 1.6(1.6) 9.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.7 3.8sec 2.8sec 73.69% 68.27% 28.7(28.7) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.92%
  • elemental_focus_2:52.77%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.3 7.1 11.9sec 9.1sec 25.63% 42.84% 7.2(7.2) 1.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.63%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 29.81% 29.81% 4.3(4.3) 12.6

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 87.2sec 87.2sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.76%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.45% 13.45% 0.0(0.0) 3.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.45%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.4sec 0.0sec 39.82% 39.82% 0.0(0.0) 1.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.7sec 31.5sec 31.32% 38.75% 2.5(6.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.95%
  • power_of_the_maelstrom_2:7.11%
  • power_of_the_maelstrom_3:18.26%

Trigger Attempt Success

  • trigger_pct:15.11%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.3 0.0 43.9sec 43.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.15%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.33% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.61%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.5 9.1sec
Lava Surge: Wasted 7.2 30.8sec
Lava Surge: During Lava Burst 4.4 53.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6300.00116.65915.9370.00019.677
Fire Elemental0.3450.0011.2490.0970.0001.249
Ascendance1.8320.0018.5331.6070.0008.533
Lava Burst2.9280.00135.53344.4449.852102.471
Elemental Blast2.1280.00120.62635.71718.62762.312

Resources

Resource Usage Type Count Total Average RPE APR
fs_fs
earth_shock Maelstrom 76.7 9100.8 118.6 903.2 2223.2
earthquake Maelstrom 384.9 19244.5 50.0 380.7 11982.9
flame_shock Maelstrom 200.8 3799.7 18.9 144.1 7241.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 438.56 5206.54 (16.02%) 11.87 56.20 1.07%
Lava Burst Overload Maelstrom 279.09 2444.88 (7.52%) 8.76 66.96 2.67%
Lava Beam Maelstrom 57.60 1620.09 (4.98%) 28.13 44.72 2.69%
Lava Beam Overload Maelstrom 86.08 1613.92 (4.97%) 18.75 80.18 4.73%
Chain Lightning Maelstrom 339.84 7885.56 (24.26%) 23.20 141.26 1.76%
Chain Lightning Overload Maelstrom 411.79 6900.93 (21.23%) 16.76 390.42 5.35%
Lightning Bolt Maelstrom 313.07 2495.66 (7.68%) 7.97 8.91 0.36%
Lightning Bolt Overload Maelstrom 351.93 2091.13 (6.43%) 5.94 20.46 0.97%
Resonance Totem Maelstrom 2273.94 2245.05 (6.91%) 0.99 28.89 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.23 14.07
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.55 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data fs_fs Fight Length
Count 7576
Mean 300.01
Minimum 240.00
Maximum 360.04
Spread ( max - min ) 120.04
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.2322
5th Percentile 245.30
95th Percentile 354.74
( 95th Percentile - 5th Percentile ) 109.44
Mean Distribution
Standard Deviation 0.4048
95.00% Confidence Intervall ( 299.22 - 300.81 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 530
0.1% Error 52978
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1060
DPS
Sample Data fs_fs Damage Per Second
Count 7576
Mean 2099057.97
Minimum 1745957.55
Maximum 2654491.96
Spread ( max - min ) 908534.41
Range [ ( max - min ) / 2 * 100% ] 21.64%
Standard Deviation 111822.6403
5th Percentile 1923481.87
95th Percentile 2289273.89
( 95th Percentile - 5th Percentile ) 365792.02
Mean Distribution
Standard Deviation 1284.7238
95.00% Confidence Intervall ( 2096539.96 - 2101575.98 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 10903
0.1 Scale Factor Error with Delta=300 106743922
0.05 Scale Factor Error with Delta=300 426975686
0.01 Scale Factor Error with Delta=300 10674392149
Priority Target DPS
Sample Data fs_fs Priority Target Damage Per Second
Count 7576
Mean 967413.41
Minimum 833856.26
Maximum 1140535.37
Spread ( max - min ) 306679.11
Range [ ( max - min ) / 2 * 100% ] 15.85%
Standard Deviation 42788.5593
5th Percentile 898395.90
95th Percentile 1039083.61
( 95th Percentile - 5th Percentile ) 140687.71
Mean Distribution
Standard Deviation 491.5953
95.00% Confidence Intervall ( 966449.90 - 968376.92 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7515
0.1 Scale Factor Error with Delta=300 15629281
0.05 Scale Factor Error with Delta=300 62517124
0.01 Scale Factor Error with Delta=300 1562928090
DPS(e)
Sample Data fs_fs Damage Per Second (Effective)
Count 7576
Mean 2099057.97
Minimum 1745957.55
Maximum 2654491.96
Spread ( max - min ) 908534.41
Range [ ( max - min ) / 2 * 100% ] 21.64%
Damage
Sample Data fs_fs Damage
Count 7576
Mean 604831054.23
Minimum 421060586.21
Maximum 833236616.25
Spread ( max - min ) 412176030.05
Range [ ( max - min ) / 2 * 100% ] 34.07%
DTPS
Sample Data fs_fs Damage Taken Per Second
Count 7576
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fs_fs Healing Per Second
Count 7576
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fs_fs Healing Per Second (Effective)
Count 7576
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fs_fs Heal
Count 7576
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fs_fs Healing Taken Per Second
Count 7576
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fs_fs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data fs_fsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fs_fs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.97 totem_mastery,if=buff.resonance_totem.remains<2
9 1.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.92 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.84 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.02 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.47 earthquake
J 1.61 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.68 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.40 lava_beam
M 35.58 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.81 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.98 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.76 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.03 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.75 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.06 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.93 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.82 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.74 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.03 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.16 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.73 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.69 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWTWWWLILIILLIIMHHSWWXdddddccTWSccQcHIMIMMIMSWWWXXWdddYWWSXdddWdFIMIMIMIIHKMHWWbbIMIMIJHJHMMIIMIOMSWW8XAXbcWWTWSWbQbFHMIMIIMISWWXbbbdWTdSccQWIMMIIMIOMKJMIMMIMMIGLKWWQWIFLIILLISWWXdWTdWXbS97bbQIMMIMIMIIISWW8XWXAbWbbWTSWWbQWIMFIMIMIMSWWXbbTbWbXSWWQWIMIIMMIISWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.878 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.965 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.031 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.099 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.897 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.696 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.495 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.294 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.294 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.381 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.467 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.554 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.371 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.458 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.545 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.631 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.717 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.534 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.620 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.436 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.253 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.339 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.425 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.242 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.059 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.145 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.961 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.777 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.864 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.900 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.938 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.717 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.754 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.791 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.827 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.863 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.878 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.894 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.910 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.708 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.775 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.924 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.989 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.371 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.410 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.820 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.880 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.942 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.354 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.394 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:51.778 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.162 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.201 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.585 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.997 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.343 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.353 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.700 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.710 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.721 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.733 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:04.669 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:05.605 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:06.543 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:07.297 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:08.051 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:09.033 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:10.016 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:10.770 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:11.706 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:12.642 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:13.579 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:14.336 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:15.274 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:16.028 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:17.218 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:18.384 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:19.551 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:20.717 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:21.936 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:23.157 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:24.378 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.418 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.477 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.887 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.233 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.243 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.591 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.937 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.284 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.630 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.640 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.985 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.044 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.455 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.515 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.575 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:43.634 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.693 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.751 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.159 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:48.571 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:49.609 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:50.648 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:52.032 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:53.071 aoe O flame_shock Fluffy_Pillow_Pack_Beast5 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom movement, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:54.109 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:55.490 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:56.875 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:57.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:59.347 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:00.101 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.161 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.161 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.221 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.634 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.045 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.103 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.161 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.220 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.632 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.042 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:12.363 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:13.683 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:14.675 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:15.995 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:16.985 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:17.975 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.984 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.995 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.006 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.018 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.077 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.137 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.197 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.608 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.667 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.014 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.024 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.370 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.691 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.010 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.330 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.652 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:37.644 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:39.028 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:40.411 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.759 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.105 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.116 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.463 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.475 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.821 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.169 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.180 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.191 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.602 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.662 aoe O flame_shock Fluffy_Pillow_Pack_Beast5 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom movement, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.721 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.105 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.488 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.527 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.848 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.838 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.159 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.479 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.471 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.818 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.165 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.176 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.294 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.678 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.063 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.383 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.704 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.696 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.043 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.056 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.067 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.414 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.426 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.438 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom ascendance, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.850 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom ascendance, lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.261 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.321 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.732 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.203 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.263 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.673 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.733 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.792 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.204 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.615 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.675 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.086 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.497 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:41.488 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.488 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.808 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:44.128 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:45.119 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:46.111 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:47.434 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.755 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:49.747 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:51.068 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:51.823 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:52.784 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:53.538 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:54.293 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:55.048 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:56.030 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:56.966 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:57.903 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:58.657 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:59.413 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:00.168 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:00.923 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:00.923 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:01.858 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:02.612 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:03.548 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:05.132 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:06.716 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:07.962 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:09.687 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:10.933 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:12.317 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:13.701 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:14.740 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:15.780 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:16.817 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:18.229 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:19.289 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:20.349 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:21.410 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:22.470 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:23.530 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:24.589 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:25.626 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:27.009 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:28.047 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:29.430 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:30.468 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:31.879 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:33.290 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:34.348 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:35.760 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:37.170 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:38.582 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:39.645 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:41.056 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:42.115 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.173 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.233 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.643 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.702 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.114 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.174 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.233 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.646 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.058 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.116 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.174 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.587 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.933 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.278 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="fs_fs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:5:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

li_lvb : 2098764 dps, 969749 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2098764.4 2098764.4 2516.5 / 0.120% 436078.8 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
li_lvb 2098764
Chain Lightning 199468 (433860) 9.5% (20.8%) 44.7 6.02sec 2918401 2336501 Direct 176.1 243366 671405 340827 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.74 176.13 0.00 0.00 1.2491 0.0000 60032940.36 60032940.36 0.00 2336500.90 2336500.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.03 77.23% 243365.92 147181 576656 243918.87 167249 303320 33105696 33105696 0.00
crit 40.11 22.77% 671405.42 407397 1596184 672364.97 453089 990952 26927244 26927244 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 234392 11.2% 54.0 8.98sec 1306732 0 Direct 239.0 210342 581000 295211 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.98 238.96 0.00 0.00 0.0000 0.0000 70542412.29 70542412.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.25 77.10% 210341.50 123632 484391 210454.88 139456 309915 38755375 38755375 0.00
crit 54.71 22.90% 580999.64 342214 1340795 581827.30 373013 940324 31787037 31787037 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast4
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67101 3.2% 10.0 29.75sec 2007729 2108899 Direct 10.0 1418868 3924138 2007743 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9521 0.0000 20139986.40 20139986.40 0.00 2108899.10 2108899.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.67 76.50% 1418867.55 106831 1669384 1421353.27 995004 1662706 10887566 10887566 0.00
crit 2.36 23.50% 3924137.73 283053 4620854 3618663.85 0 4620854 9252420 9252420 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (768955) 0.0% (36.7%) 50.5 5.58sec 4561707 4666168

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.54 0.00 0.00 0.00 0.9776 0.0000 0.00 0.00 0.00 4666167.55 4666167.55
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 569451 27.2% 299.7 0.93sec 569628 0 Direct 1538.2 79653 220538 110999 22.2%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.74 1538.23 0.00 0.00 0.0000 0.0000 170740667.08 170740667.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.98 77.75% 79652.89 68550 89526 79689.76 75623 84258 95263041 95263041 0.00
crit 342.25 22.25% 220537.63 189746 247808 220640.55 208515 232315 75477626 75477626 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199504 9.5% 76.8 4.17sec 779416 0 Direct 76.8 558856 1546885 779408 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.76 76.76 0.00 0.00 0.0000 0.0000 59828669.99 59828669.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.63 77.68% 558856.03 536592 598966 558979.81 542456 580908 33322059 33322059 0.00
crit 17.14 22.32% 1546884.94 1485287 1657939 1547293.35 1485287 1632585 26506611 26506611 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast4
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57115 (87342) 2.7% (4.2%) 20.0 15.19sec 1308969 991366 Direct 20.0 608037 1682263 856002 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.3204 0.0000 17132934.98 17132934.98 0.00 991365.59 991365.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.40 76.92% 608037.06 521261 680768 608145.61 556631 649536 9361417 9361417 0.00
crit 4.62 23.08% 1682263.08 1442850 1884366 1671099.88 0 1884366 7771518 7771518 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30227 1.4% 12.6 23.12sec 717342 0 Direct 12.6 510683 1414314 717261 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.64 12.64 0.00 0.00 0.0000 0.0000 9066874.95 9066874.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.75 77.13% 510682.97 437859 571845 510771.62 444385 559935 4978662 4978662 0.00
crit 2.89 22.87% 1414313.81 1211994 1582868 1349591.11 0 1582868 4088213 4088213 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86941 4.1% 26.5 11.20sec 981467 1020717 Direct 26.5 92545 256574 131022 23.5%  
Periodic 316.4 50712 140387 71327 23.0% 133.2%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.53 26.53 316.38 316.38 0.9616 1.2631 26042582.50 26042582.50 0.00 61256.34 1020717.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.31 76.54% 92544.85 77837 101655 92417.44 81839 98127 1879518 1879518 0.00
crit 6.23 23.46% 256574.24 215453 281381 255593.49 0 281381 1597203 1597203 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.7 77.01% 50711.85 32 55911 50681.22 45955 52994 12355944 12355944 0.00
crit 72.7 22.99% 140387.12 99 154763 140299.67 126980 147726 10209917 10209917 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65230 (147302) 3.1% (6.9%) 7.6 28.48sec 5763215 4923773 Direct 36.4 382170 1051722 530005 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 36.38 0.00 0.00 1.1706 0.0000 19280726.48 19280726.48 0.00 4923772.60 4923772.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.34 77.91% 382170.45 175131 1004613 383011.97 226093 613882 10831442 10831442 0.00
crit 8.03 22.09% 1051722.41 484763 2780769 1047932.24 0 2240922 8449284 8449284 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82072 3.9% 11.2 40.02sec 2164018 0 Direct 55.1 315797 874037 439859 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 55.14 0.00 0.00 0.0000 0.0000 24250347.06 24250347.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.88 77.77% 315797.16 147109 843868 316678.37 189409 610105 13540684 13540684 0.00
crit 12.25 22.23% 874036.96 407197 2335828 877428.10 0 2335828 10709663 10709663 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 166619 (270876) 7.9% (12.9%) 57.7 5.11sec 1402902 1237673 Direct 57.7 276716 862981 862938 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.75 57.75 0.00 0.00 1.1335 0.0000 49833717.42 49833717.42 0.00 1237673.07 1237673.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 276716.48 233102 304432 1171.75 0 304432 1172 1172 0.00
crit 57.74 99.99% 862981.11 711167 1196298 863576.32 820331 917771 49832546 49832546 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 85586 4.1% 36.7 7.98sec 696824 0 Direct 36.7 230878 696854 696821 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.74 36.74 0.00 0.00 0.0000 0.0000 25602485.86 25602485.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 230878.27 195806 255723 611.03 0 255723 611 611 0.00
crit 36.74 99.99% 696854.30 574572 966524 697353.72 645432 759221 25601875 25601875 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18671 0.9% 43.3 6.23sec 128830 0 Direct 100.3 44786 91316 55620 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.31 100.32 0.00 0.00 0.0000 0.0000 5579400.24 5579400.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.96 76.72% 44785.56 42943 47934 44787.18 42943 47575 3446642 3446642 0.00
crit 23.36 23.28% 91315.74 87603 97785 91329.55 87603 97785 2132758 2132758 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49304 (96099) 2.4% (4.6%) 40.8 7.18sec 707494 583124 Direct 40.8 227251 632241 363006 33.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.84 40.84 0.00 0.00 1.2133 0.0000 14826853.56 14826853.56 0.00 583124.11 583124.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.15 66.47% 227251.06 154272 604437 228324.34 174259 359315 6169606 6169606 0.00
crit 13.69 33.53% 632241.35 427024 1673082 634934.82 439752 1304888 8657248 8657248 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46795 2.2% 45.8 8.54sec 306858 0 Direct 45.8 191628 534479 306866 33.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.85 45.85 0.00 0.00 0.0000 0.0000 14069278.72 14069278.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.44 66.39% 191628.43 129588 507727 192031.24 144572 341481 5832411 5832411 0.00
crit 15.41 33.61% 534478.86 358700 1405389 535883.86 362710 1074420 8236868 8236868 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59892) 0.0% (2.8%) 3.0 120.33sec 5976958 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.83 0.00 0.0000 1.0000 0.00 0.00 0.00 308371.94 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19264 0.9% 38.0 6.92sec 151105 0 Direct 38.0 121869 248614 151107 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.95 37.95 0.00 0.00 0.0000 0.0000 5734544.60 5734544.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.20 76.93% 121869.49 121869 121869 121869.49 121869 121869 3558212 3558212 0.00
crit 8.75 23.07% 248613.77 248614 248614 248547.97 0 248614 2176333 2176333 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40627 1.9% 98.9 2.62sec 122366 0 Direct 98.9 98655 201256 122366 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.88 98.88 0.00 0.00 0.0000 0.0000 12099838.08 12099838.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.03 76.89% 98654.92 98655 98655 98654.92 98655 98655 7500777 7500777 0.00
crit 22.85 23.11% 201256.04 201256 201256 201256.04 201256 201256 4599061 4599061 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143134 / 55218
Fire Blast 143134 2.6% 63.1 4.28sec 260782 145749 Direct 63.1 212304 424640 260782 22.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.09 63.09 0.00 0.00 1.7893 0.0000 16452103.51 16452103.51 0.00 145748.61 145748.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.68 77.17% 212303.85 199011 222144 212303.07 207654 218773 10335846 10335846 0.00
crit 14.40 22.83% 424640.33 398022 444288 424619.38 413592 444288 6116257 6116257 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185490 / 25178
Lightning Blast 185490 1.2% 40.1 7.03sec 188403 201236 Direct 40.1 153752 307738 188408 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.09 40.09 0.00 0.00 0.9362 0.0000 7552997.99 7552997.99 0.00 201236.19 201236.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.07 77.50% 153751.94 147415 164551 153794.37 149298 161686 4776653 4776653 0.00
crit 9.02 22.50% 307737.80 294831 329102 307811.09 294831 329102 2776345 2776345 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
li_lvb
Ascendance 2.0 181.74sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0339 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.01sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8127 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.62sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5099 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.78% 0.0(0.0) 2.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.2 35.4sec 24.9sec 32.22% 32.22% 3.2(3.2) 8.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.74% 8.74% 0.0(0.0) 3.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.74%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.6sec 25.7sec 31.64% 31.64% 1.3(1.3) 9.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.6sec 31.55% 31.55% 1.3(1.3) 9.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.6sec 30.58% 30.58% 1.6(1.6) 9.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.8 3.8sec 2.8sec 73.74% 68.28% 28.8(28.8) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.92%
  • elemental_focus_2:52.82%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.5 7.2 11.8sec 9.1sec 25.65% 42.90% 7.3(7.3) 1.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.65%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.68% 29.68% 4.2(4.2) 12.6

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.4sec 85.4sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.67%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.3sec 0.0sec 39.82% 39.82% 0.0(0.0) 1.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.8sec 31.4sec 31.50% 38.81% 2.5(6.1) 2.1

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.82%
  • power_of_the_maelstrom_2:7.06%
  • power_of_the_maelstrom_3:18.62%

Trigger Attempt Success

  • trigger_pct:15.07%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.1sec 44.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.04%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.30% 9.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.10%
  • stormkeeper_2:3.60%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.09% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.7 9.1sec
Lava Surge: Wasted 7.3 30.4sec
Lava Surge: During Lava Burst 4.4 53.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6160.00116.64915.9380.03319.452
Fire Elemental0.3490.0011.2480.1020.0001.248
Ascendance1.8970.0019.4221.6630.0009.422
Lava Burst2.9090.00137.59744.2899.07799.149
Elemental Blast2.1230.00119.63235.55219.43261.076

Resources

Resource Usage Type Count Total Average RPE APR
li_lvb
earth_shock Maelstrom 77.0 9142.5 118.7 911.4 2202.9
earthquake Maelstrom 388.2 19410.3 50.0 384.0 11878.7
flame_shock Maelstrom 203.8 3858.0 18.9 145.4 6750.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 443.53 5265.07 (16.07%) 11.87 57.28 1.08%
Lava Burst Overload Maelstrom 282.19 2472.49 (7.55%) 8.76 67.27 2.65%
Lava Beam Maelstrom 58.01 1633.21 (4.98%) 28.16 42.84 2.56%
Lava Beam Overload Maelstrom 86.08 1618.50 (4.94%) 18.80 75.62 4.46%
Chain Lightning Maelstrom 343.64 7971.29 (24.33%) 23.20 145.28 1.79%
Chain Lightning Overload Maelstrom 414.59 6949.66 (21.21%) 16.76 391.17 5.33%
Lightning Bolt Maelstrom 313.66 2500.23 (7.63%) 7.97 9.08 0.36%
Lightning Bolt Overload Maelstrom 352.12 2092.04 (6.38%) 5.94 20.66 0.98%
Resonance Totem Maelstrom 2293.58 2264.56 (6.91%) 0.99 29.02 1.27%
Resource RPS-Gain RPS-Loss
Maelstrom 14.22 14.07
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.88 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data li_lvb Fight Length
Count 7557
Mean 300.02
Minimum 240.00
Maximum 360.01
Spread ( max - min ) 120.01
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.3975
5th Percentile 245.10
95th Percentile 354.91
( 95th Percentile - 5th Percentile ) 109.81
Mean Distribution
Standard Deviation 0.4072
95.00% Confidence Intervall ( 299.22 - 300.82 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 535
0.1% Error 53474
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1070
DPS
Sample Data li_lvb Damage Per Second
Count 7557
Mean 2098764.40
Minimum 1757052.51
Maximum 2661096.40
Spread ( max - min ) 904043.89
Range [ ( max - min ) / 2 * 100% ] 21.54%
Standard Deviation 111615.5346
5th Percentile 1922818.48
95th Percentile 2285963.67
( 95th Percentile - 5th Percentile ) 363145.19
Mean Distribution
Standard Deviation 1283.9554
95.00% Confidence Intervall ( 2096247.89 - 2101280.90 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10865
0.1 Scale Factor Error with Delta=300 106348889
0.05 Scale Factor Error with Delta=300 425395555
0.01 Scale Factor Error with Delta=300 10634888871
Priority Target DPS
Sample Data li_lvb Priority Target Damage Per Second
Count 7557
Mean 969748.63
Minimum 818595.53
Maximum 1135227.86
Spread ( max - min ) 316632.33
Range [ ( max - min ) / 2 * 100% ] 16.33%
Standard Deviation 42474.9183
5th Percentile 903110.03
95th Percentile 1042052.11
( 95th Percentile - 5th Percentile ) 138942.09
Mean Distribution
Standard Deviation 488.6049
95.00% Confidence Intervall ( 968790.98 - 970706.27 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7370
0.1 Scale Factor Error with Delta=300 15400995
0.05 Scale Factor Error with Delta=300 61603980
0.01 Scale Factor Error with Delta=300 1540099479
DPS(e)
Sample Data li_lvb Damage Per Second (Effective)
Count 7557
Mean 2098764.40
Minimum 1757052.51
Maximum 2661096.40
Spread ( max - min ) 904043.89
Range [ ( max - min ) / 2 * 100% ] 21.54%
Damage
Sample Data li_lvb Damage
Count 7557
Mean 604804260.58
Minimum 408284788.99
Maximum 827027356.11
Spread ( max - min ) 418742567.12
Range [ ( max - min ) / 2 * 100% ] 34.62%
DTPS
Sample Data li_lvb Damage Taken Per Second
Count 7557
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data li_lvb Healing Per Second
Count 7557
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data li_lvb Healing Per Second (Effective)
Count 7557
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data li_lvb Heal
Count 7557
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data li_lvb Healing Taken Per Second
Count 7557
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data li_lvb Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data li_lvbTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data li_lvb Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.97 totem_mastery,if=buff.resonance_totem.remains<2
9 1.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.91 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.83 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.02 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.35 earthquake
J 1.61 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.67 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.37 lava_beam
M 35.60 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.80 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.96 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.76 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 17.99 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.70 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.03 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.94 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.94 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.73 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.09 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.73 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.42 lightning_bolt
e 0.14 flame_shock,moving=1,target_if=refreshable
f 0.36 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWWWTWLILLIILILMSTWWWXbbbdWTWcScccQWIMIIMIIMSWWXUXcccWWTScccQMIMMMIIIMSWWXbbbdWTdSddQMMIIIMIMSW8WXAXWbbWbSTddQWFMIMIMIMISWWXbbbTcWWSXcccQWTMMIIMMIIMSWRWXdXdWdPWSWWIIFLLILIISWWXddYdWQXS97WWXMMIMIIMMS8TWWAXWXXddWSdWdIMIFMIIMIMSWTWbbbebddWdSTdddWIMMIMIIMIKMMMI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.007 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.073 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.873 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.671 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.470 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.269 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.269 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:09.335 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:10.400 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.465 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.532 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.619 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.434 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.519 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.584 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.383 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.447 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.513 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.311 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.110 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.198 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.015 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.101 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.188 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.275 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.092 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.908 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.725 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.810 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.626 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.715 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.803 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.889 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.975 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.794 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.611 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.676 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.739 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.805 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.871 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.937 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.321 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.380 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.790 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.851 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.262 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.323 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.382 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.793 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.852 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.911 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.322 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.733 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.794 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.139 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.150 single_asc U stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.160 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.169 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.181 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.190 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.200 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.211 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.557 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.617 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.142 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.553 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.900 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:14.222 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.214 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.534 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.525 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.847 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.167 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.513 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.572 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.692 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.102 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.514 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.525 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.872 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.883 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.230 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.577 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.924 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.271 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.619 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.678 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.089 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.499 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.911 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.324 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.382 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.794 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.206 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.265 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.326 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.385 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.797 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.857 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.269 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.680 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:58.064 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:58.817 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:00.199 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.238 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.238 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:02.276 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:03.316 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.729 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:06.113 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:07.497 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:08.880 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:10.264 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:11.303 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:12.622 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:13.943 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:14.954 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:15.963 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.974 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.985 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.995 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.007 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.017 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.075 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.133 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.544 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.605 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.017 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.363 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.711 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.720 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.068 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.414 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.761 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.772 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.117 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:37.871 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:38.855 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:39.973 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:40.728 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:41.646 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:42.564 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:43.484 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:44.239 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:44.994 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:45.748 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:46.686 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:47.621 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:48.376 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:49.131 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:50.717 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:52.347 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:53.569 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:54.792 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:56.420 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:58.081 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.138 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.198 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.611 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.670 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.082 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.142 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.552 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.963 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.374 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.374 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.785 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.198 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.610 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom ascendance, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.022 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.079 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.137 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.196 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.609 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.021 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.080 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.491 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.528 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.568 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.953 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.990 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.373 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.432 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.844 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.258 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.317 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.728 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.141 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.201 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.258 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.668 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.727 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.727 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.786 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:44.195 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:45.255 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:46.666 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:48.076 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:49.137 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:50.549 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:51.610 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:52.668 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:54.079 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.491 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:56.902 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.657 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.718 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.129 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.540 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.540 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.601 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:03.662 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:04.720 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:05.780 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.192 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:08.605 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:09.988 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:11.372 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:12.755 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:13.746 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:15.069 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.078 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.425 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.436 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.446 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.457 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:21.466 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:22.476 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:23.534 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:24.593 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.650 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:27.062 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.474 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:29.533 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:30.945 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:31.928 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:32.909 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:33.663 single_asc e flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom movement, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:34.418 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:35.400 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:36.383 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:37.365 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:38.347 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:39.330 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:40.312 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:41.067 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:42.050 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:43.034 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:44.695 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:45.918 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:47.140 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:48.766 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:50.394 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:51.615 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.597 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:53.352 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom movement, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:54.108 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:55.072 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:55.825 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:56.789 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:57.751 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:58.713 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:59.695 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="li_lvb"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:5:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

mb_lvs : 2096885 dps, 968246 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2096885.3 2096885.3 2513.8 / 0.120% 426460.7 / 20.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mb_lvs 2096885
Chain Lightning 199167 (433584) 9.5% (20.8%) 44.5 6.00sec 2930367 2346314 Direct 175.5 243638 672402 341439 22.8%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.53 175.54 0.00 0.00 1.2489 0.0000 59933231.61 59933231.61 0.00 2346314.38 2346314.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.50 77.19% 243638.23 147181 576656 244095.64 162791 304765 33013876 33013876 0.00
crit 40.04 22.81% 672401.76 407397 1596184 673536.19 449442 986122 26919355 26919355 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 234417 11.2% 53.9 8.97sec 1309560 0 Direct 238.9 210588 580811 295387 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.88 238.85 0.00 0.00 0.0000 0.0000 70554696.45 70554696.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.15 77.10% 210588.45 123632 484391 210870.01 134624 302069 38780137 38780137 0.00
crit 54.71 22.90% 580811.24 342214 1340795 581885.66 375114 916656 31774559 31774559 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear1
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67134 3.2% 10.0 29.95sec 2008035 2108500 Direct 10.0 1417960 3931223 2007976 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 10.04 0.00 0.00 0.9524 0.0000 20159366.51 20159366.51 0.00 2108499.79 2108499.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.68 76.52% 1417959.92 102259 1669384 1420887.72 922223 1656029 10893472 10893472 0.00
crit 2.36 23.48% 3931223.25 283053 4620854 3638088.08 0 4620854 9265894 9265894 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (769063) 0.0% (36.7%) 50.5 5.58sec 4564257 4668528

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.51 0.00 0.00 0.00 0.9777 0.0000 0.00 0.00 0.00 4668528.01 4668528.01
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 569163 27.2% 299.6 0.93sec 569476 0 Direct 1537.4 79645 220489 110982 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.61 1537.38 0.00 0.00 0.0000 0.0000 170621808.34 170621808.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1195.31 77.75% 79644.55 68550 89526 79678.09 76042 83982 95199443 95199443 0.00
crit 342.07 22.25% 220488.55 189746 247808 220585.85 209720 230951 75422366 75422366 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199900 9.5% 76.9 4.16sec 779142 0 Direct 76.9 558885 1546721 779151 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.91 76.91 0.00 0.00 0.0000 0.0000 59924110.19 59924110.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.76 77.70% 558884.55 536592 598966 559009.46 544531 579774 33399558 33399558 0.00
crit 17.15 22.30% 1546720.89 1485287 1657939 1547165.76 1485287 1630713 26524553 26524553 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57167 (87337) 2.7% (4.2%) 20.0 15.24sec 1308258 990528 Direct 20.0 607820 1681925 856462 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.01 20.01 0.00 0.00 1.3208 0.0000 17141027.79 17141027.79 0.00 990527.70 990527.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.38 76.85% 607820.37 521261 680768 607921.97 559670 651404 9348313 9348313 0.00
crit 4.63 23.15% 1681925.39 1442850 1884366 1671055.88 0 1884366 7792715 7792715 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30171 1.4% 12.6 23.09sec 716653 0 Direct 12.6 510675 1413256 716635 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.62 12.62 0.00 0.00 0.0000 0.0000 9041590.86 9041590.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.74 77.18% 510674.82 437859 571845 510765.07 454086 553522 4972513 4972513 0.00
crit 2.88 22.82% 1413255.54 1211994 1582868 1348182.73 0 1582868 4069078 4069078 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86801 4.1% 26.4 11.23sec 983242 1022248 Direct 26.4 92545 256431 130672 23.3%  
Periodic 315.9 50700 140355 71360 23.0% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.44 26.44 315.90 315.90 0.9619 1.2636 25997803.92 25997803.92 0.00 61228.35 1022247.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 76.74% 92545.44 77837 101655 92410.50 82821 97909 1877753 1877753 0.00
crit 6.15 23.26% 256430.81 215453 281381 255223.11 0 281381 1577260 1577260 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.1 76.96% 50699.63 27 55911 50668.35 45469 53391 12325500 12325500 0.00
crit 72.8 23.04% 140354.73 84 154763 140262.90 127293 147260 10217291 10217291 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65084 (147473) 3.1% (6.9%) 7.6 28.54sec 5770270 4927412 Direct 36.4 381012 1050307 529031 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 36.38 0.00 0.00 1.1711 0.0000 19245565.25 19245565.25 0.00 4927412.41 4927412.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.33 77.89% 381012.37 175131 1004613 381794.95 227806 576635 10795803 10795803 0.00
crit 8.04 22.11% 1050307.36 484763 2780769 1045897.50 0 2491191 8449762 8449762 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82389 3.9% 11.2 40.52sec 2171419 0 Direct 55.2 316375 876972 441440 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 55.20 0.00 0.00 0.0000 0.0000 24366961.97 24366961.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.88 77.69% 316374.66 147109 843868 317650.67 183343 616453 13566345 13566345 0.00
crit 12.32 22.31% 876972.18 407197 2335828 880034.90 0 1997465 10800617 10800617 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 165681 (268522) 7.9% (12.8%) 57.6 5.13sec 1393554 1228525 Direct 57.6 259608 859915 859889 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.63 57.63 0.00 0.00 1.1343 0.0000 49554368.21 49554368.21 0.00 1228525.17 1228525.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 259607.79 227021 296490 600.13 0 296490 600 600 0.00
crit 57.63 100.00% 859914.85 708669 1192097 860502.07 819513 912373 49553768 49553768 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 84399 4.0% 36.7 8.06sec 688363 0 Direct 36.7 215571 688386 688361 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.67 36.67 0.00 0.00 0.0000 0.0000 25243149.86 25243149.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 215570.73 190698 249052 410.95 0 249052 411 411 0.00
crit 36.67 99.99% 688385.92 567517 954655 688873.87 638596 742153 25242739 25242739 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18442 0.9% 42.9 6.34sec 128390 0 Direct 99.1 44791 91331 55598 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.93 99.13 0.00 0.00 0.0000 0.0000 5511172.13 5511172.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.11 76.78% 44791.40 42943 47934 44793.07 43002 47524 3409102 3409102 0.00
crit 23.02 23.22% 91331.39 87603 97785 91350.00 87603 97215 2102070 2102070 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49629 (96578) 2.4% (4.6%) 41.2 7.17sec 705731 581305 Direct 41.2 227248 630268 362699 33.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.16 41.16 0.00 0.00 1.2140 0.0000 14927914.59 14927914.59 0.00 581304.89 581304.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.32 66.39% 227248.00 154272 604437 228378.93 173308 402195 6209430 6209430 0.00
crit 13.83 33.61% 630267.97 427024 1673082 631924.15 436570 1326432 8718484 8718484 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46949 2.2% 46.1 8.56sec 306423 0 Direct 46.1 191514 534447 306409 33.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.07 46.07 0.00 0.00 0.0000 0.0000 14118146.66 14118146.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.64 66.49% 191513.99 129588 507727 192015.01 140820 334772 5867524 5867524 0.00
crit 15.44 33.51% 534446.53 358700 1405389 536679.58 377597 1405389 8250623 8250623 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59944) 0.0% (2.8%) 3.0 120.33sec 5975928 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.94 0.00 0.0000 1.0000 0.00 0.00 0.00 308015.42 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19294 0.9% 38.0 6.90sec 151126 0 Direct 38.0 121869 248614 151123 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.01 38.01 0.00 0.00 0.0000 0.0000 5744234.96 5744234.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.24 76.92% 121869.49 121869 121869 121869.49 121869 121869 3562940 3562940 0.00
crit 8.77 23.08% 248613.77 248614 248614 248613.77 248614 248614 2181295 2181295 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40650 1.9% 99.0 2.61sec 122264 0 Direct 99.0 98655 201256 122264 23.0%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.98 98.98 0.00 0.00 0.0000 0.0000 12102178.76 12102178.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.21 76.99% 98654.92 98655 98655 98654.92 98655 98655 7518260 7518260 0.00
crit 22.78 23.01% 201256.04 201256 201256 201256.04 201256 201256 4583919 4583919 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143195 / 55305
Fire Blast 143195 2.6% 63.1 4.27sec 261114 145813 Direct 63.1 212347 424685 261114 23.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.10 63.10 0.00 0.00 1.7908 0.0000 16476390.33 16476390.33 0.00 145812.64 145812.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.61 77.03% 212346.64 199011 222144 212346.35 207427 218913 10321733 10321733 0.00
crit 14.49 22.97% 424685.39 398022 444288 424680.64 411862 444288 6154657 6154657 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185189 / 25144
Lightning Blast 185189 1.2% 40.0 7.06sec 188408 200972 Direct 40.0 153747 307603 188412 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.03 40.03 0.00 0.00 0.9375 0.0000 7542468.38 7542468.38 0.00 200971.71 200971.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 77.47% 153747.27 147415 164551 153790.88 149269 161493 4768230 4768230 0.00
crit 9.02 22.53% 307602.61 294831 329102 307634.11 0 329102 2774238 2774238 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
mb_lvs
Ascendance 2.0 181.66sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0343 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.07sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 0.00 0.00 0.8136 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.62sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5092 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.6sec 181.6sec 10.14% 15.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.14% 32.14% 3.1(3.1) 8.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.1sec 69.1sec 8.63% 8.63% 0.0(0.0) 3.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.63%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.6sec 25.7sec 31.59% 31.59% 1.3(1.3) 9.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.6sec 31.69% 31.69% 1.3(1.3) 9.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.69%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.7sec 30.47% 30.47% 1.6(1.6) 8.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.4 28.8 3.8sec 2.8sec 73.73% 68.28% 28.8(28.8) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.91%
  • elemental_focus_2:52.83%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.3 7.1 11.9sec 9.1sec 25.58% 42.84% 7.2(7.2) 1.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.58%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.0sec 29.85% 29.85% 4.2(4.2) 12.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 86.0sec 86.0sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:79.02%
Nefarious Pact 3.4 0.0 69.5sec 69.5sec 13.43% 13.43% 0.0(0.0) 3.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.43%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.5sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.7sec 31.4sec 31.47% 38.37% 2.5(6.0) 2.1

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.87%
  • power_of_the_maelstrom_2:7.13%
  • power_of_the_maelstrom_3:18.46%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.4sec 44.4sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.04%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.32% 9.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.12%
  • stormkeeper_2:3.60%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.6 9.1sec
Lava Surge: Wasted 7.3 30.5sec
Lava Surge: During Lava Burst 4.3 53.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6140.00116.65215.9400.07319.966
Fire Elemental0.3260.0011.2490.0890.0001.249
Ascendance1.8670.0018.7481.6490.0008.748
Lava Burst2.9230.00135.36744.4778.26298.828
Elemental Blast2.1300.00120.66735.70118.51862.749

Resources

Resource Usage Type Count Total Average RPE APR
mb_lvs
earth_shock Maelstrom 79.1 9386.3 118.7 934.9 2147.8
earthquake Maelstrom 398.0 19901.5 50.0 394.0 11584.3
flame_shock Maelstrom 208.4 3943.7 18.9 149.2 6592.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 454.10 5391.64 (16.05%) 11.87 57.56 1.06%
Lava Burst Overload Maelstrom 288.97 2532.18 (7.54%) 8.76 68.51 2.63%
Lava Beam Maelstrom 59.56 1675.47 (4.99%) 28.13 44.54 2.59%
Lava Beam Overload Maelstrom 88.43 1662.15 (4.95%) 18.80 77.88 4.48%
Chain Lightning Maelstrom 350.88 8148.84 (24.25%) 23.22 150.47 1.81%
Chain Lightning Overload Maelstrom 424.53 7125.37 (21.21%) 16.78 403.08 5.35%
Lightning Bolt Maelstrom 324.33 2585.76 (7.70%) 7.97 8.89 0.34%
Lightning Bolt Overload Maelstrom 363.08 2156.62 (6.42%) 5.94 21.86 1.00%
Resonance Totem Maelstrom 2353.11 2323.61 (6.92%) 0.99 29.50 1.25%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.06
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.04 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data mb_lvs Fight Length
Count 7344
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.0192
5th Percentile 246.08
95th Percentile 353.92
( 95th Percentile - 5th Percentile ) 107.84
Mean Distribution
Standard Deviation 0.4086
95.00% Confidence Intervall ( 299.20 - 300.80 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 524
0.1% Error 52345
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1047
DPS
Sample Data mb_lvs Damage Per Second
Count 7344
Mean 2096885.32
Minimum 1749512.21
Maximum 2556658.22
Spread ( max - min ) 807146.00
Range [ ( max - min ) / 2 * 100% ] 19.25%
Standard Deviation 109911.1632
5th Percentile 1925058.25
95th Percentile 2283725.82
( 95th Percentile - 5th Percentile ) 358667.57
Mean Distribution
Standard Deviation 1282.5534
95.00% Confidence Intervall ( 2094371.56 - 2099399.08 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10555
0.1 Scale Factor Error with Delta=300 103125788
0.05 Scale Factor Error with Delta=300 412503150
0.01 Scale Factor Error with Delta=300 10312578729
Priority Target DPS
Sample Data mb_lvs Priority Target Damage Per Second
Count 7344
Mean 968246.01
Minimum 816276.05
Maximum 1149797.74
Spread ( max - min ) 333521.68
Range [ ( max - min ) / 2 * 100% ] 17.22%
Standard Deviation 42212.7312
5th Percentile 901449.92
95th Percentile 1040256.76
( 95th Percentile - 5th Percentile ) 138806.84
Mean Distribution
Standard Deviation 492.5804
95.00% Confidence Intervall ( 967280.57 - 969211.45 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7302
0.1 Scale Factor Error with Delta=300 15211449
0.05 Scale Factor Error with Delta=300 60845795
0.01 Scale Factor Error with Delta=300 1521144856
DPS(e)
Sample Data mb_lvs Damage Per Second (Effective)
Count 7344
Mean 2096885.32
Minimum 1749512.21
Maximum 2556658.22
Spread ( max - min ) 807146.00
Range [ ( max - min ) / 2 * 100% ] 19.25%
Damage
Sample Data mb_lvs Damage
Count 7344
Mean 604187328.08
Minimum 413705465.36
Maximum 813696621.80
Spread ( max - min ) 399991156.43
Range [ ( max - min ) / 2 * 100% ] 33.10%
DTPS
Sample Data mb_lvs Damage Taken Per Second
Count 7344
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data mb_lvs Healing Per Second
Count 7344
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data mb_lvs Healing Per Second (Effective)
Count 7344
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data mb_lvs Heal
Count 7344
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data mb_lvs Healing Taken Per Second
Count 7344
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data mb_lvs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data mb_lvsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data mb_lvs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.95 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.91 totem_mastery,if=buff.resonance_totem.remains<2
9 1.90 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.83 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.72 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 1.95 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 47.92 earthquake
J 1.56 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.60 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.17 lava_beam
M 34.51 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.75 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.79 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.70 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 17.50 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.46 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 1.98 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 53.27 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.43 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.70 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.65 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.37 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.08 lightning_bolt
e 0.13 flame_shock,moving=1,target_if=refreshable
f 0.36 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRWddWdPWWTWWWILLIILILILSWWXXbWWbbdTcXSWbXXbbMIMIMMIISWWXXWccXWcSdTdWFMIMIMIMSWWWXccYcHJHJKJIWWMIIMMIIISW8WdAdddYWddSddWYQWWHMFIMIIMSVWQWWTbbbWdSdYdMMIIIMMIRSWWdddWTdddWdddPSWWIILIFILLISWQW97VWWYbWWSWbbIIMIMMIIMS8WQWAWbbbTWSddddIMIMFIIMSWVQVTWWbWddSWTWdMIIMMIIMSWdQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.878 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.962 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.998 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.777 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.556 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.594 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.374 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.153 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.933 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.711 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.711 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.747 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, ascendance, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.783 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.559 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.594 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.681 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.583 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.670 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.757 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.573 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.391 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.477 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.294 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.380 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.180 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.245 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.310 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.074 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.090 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.852 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.616 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.632 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.394 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.411 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.427 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.445 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.482 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.260 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.297 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.115 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.392 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.408 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.426 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:42.415 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:43.405 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:44.725 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.045 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.389 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.401 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.749 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.810 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.222 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.694 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.751 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.162 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.574 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.987 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.046 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.106 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.165 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.551 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.935 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.974 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.357 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.769 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.181 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:12.564 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:13.602 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:14.987 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:16.372 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:17.412 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.471 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.530 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.590 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.649 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.709 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.768 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.179 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.590 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.000 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.992 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.313 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.305 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.625 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.945 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.938 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:36.259 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.250 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:38.290 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:39.327 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:40.364 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.775 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.835 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:43.826 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:44.819 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:46.139 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:47.459 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:48.451 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:49.443 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:50.764 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.085 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.077 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.136 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.196 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.611 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.024 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.777 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.190 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.601 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.601 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.012 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:04.394 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:05.356 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:06.109 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:07.071 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:08.032 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:08.995 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:09.979 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:10.941 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:11.904 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:12.659 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:13.414 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:14.170 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:14.923 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:15.884 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:16.638 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:18.299 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:19.545 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:20.791 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:22.036 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:23.284 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:24.531 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.588 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.000 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.011 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.019 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.030 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.376 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.367 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.359 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.680 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.999 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.318 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.701 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.112 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.496 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.880 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.917 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.300 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.684 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.098 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.159 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.217 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.276 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.659 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.043 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.083 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.121 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.504 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:58.260 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:59.197 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:00.133 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:01.068 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:02.004 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:02.758 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:03.513 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.446 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:05.383 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:06.320 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:07.257 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:08.193 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:09.177 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:10.159 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:10.159 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:11.820 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:13.482 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:15.065 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:16.254 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:17.442 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:19.027 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.037 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.048 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom ascendance, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.058 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom ascendance, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.405 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom ascendance, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.816 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.875 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.288 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.697 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.755 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.813 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.875 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.875 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.935 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:34.346 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:35.406 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:36.464 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:37.875 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:38.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:40.346 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:41.731 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.725 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:44.047 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:45.367 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.379 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:47.389 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:48.710 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:49.702 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:51.024 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:52.342 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:53.382 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:54.422 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:55.806 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:57.189 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:57.943 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:59.328 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:00.365 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.777 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.777 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.837 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:04.247 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:05.658 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.070 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.129 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.539 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.951 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:12.271 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:13.591 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:14.912 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:16.233 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:17.224 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.573 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.584 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.930 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:22.102 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:23.161 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:24.220 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:25.279 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:26.691 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:28.012 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:29.005 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:29.996 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:30.988 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:31.980 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.990 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.335 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.681 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.691 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.103 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.485 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.869 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:41.908 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.946 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:44.330 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.742 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.152 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.214 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.276 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.689 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.103 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.164 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.223 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.634 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.046 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.393 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.741 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="mb_lvs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:5:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

tgt_eq : 2113649 dps, 967035 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2113648.5 2113648.5 2532.6 / 0.120% 438879.2 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.8 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
tgt_eq 2113649
Chain Lightning 199727 (434137) 9.5% (20.6%) 44.7 5.97sec 2922999 2340074 Direct 175.8 243756 672083 341713 22.9%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.68 175.84 0.00 0.00 1.2491 0.0000 60089477.10 60089477.10 0.00 2340073.84 2340073.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.63 77.13% 243756.23 147181 576656 244354.85 167389 311071 33059461 33059461 0.00
crit 40.22 22.87% 672083.18 407397 1596184 673483.60 448647 959248 27030016 27030016 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 234411 11.1% 53.9 8.96sec 1308549 0 Direct 238.5 210726 581595 295578 22.9%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.88 238.54 0.00 0.00 0.0000 0.0000 70503023.61 70503023.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.96 77.12% 210726.39 123632 484391 211070.54 139192 318937 38760552 38760552 0.00
crit 54.58 22.88% 581595.18 342214 1340795 582608.51 381297 895043 31742472 31742472 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast3
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 67052 3.2% 10.0 30.31sec 2006721 2107468 Direct 10.0 1417959 3919110 2006611 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 10.03 0.00 0.00 0.9523 0.0000 20126317.90 20126317.90 0.00 2107467.84 2107467.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.67 76.46% 1417959.18 114146 1669384 1420542.55 959346 1621099 10873503 10873503 0.00
crit 2.36 23.54% 3919109.94 315956 4620854 3611416.45 0 4620854 9252815 9252815 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (791067) 0.0% (37.5%) 50.5 5.56sec 4699737 4804443

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.46 0.00 0.00 0.00 0.9782 0.0000 0.00 0.00 0.00 4804442.78 4804442.78
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 591985 28.0% 299.3 0.93sec 592909 0 Direct 1534.5 82980 229734 115652 22.3%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 299.32 1534.53 0.00 0.00 0.0000 0.0000 177471048.40 177471048.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1192.90 77.74% 82980.43 71406 93256 83017.24 77974 87323 98987829 98987829 0.00
crit 341.63 22.26% 229734.09 197652 258133 229831.87 218429 242041 78483219 78483219 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 199082 9.4% 76.6 4.16sec 778998 0 Direct 76.6 558868 1546935 779006 22.3%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.62 76.62 0.00 0.00 0.0000 0.0000 59690660.70 59690660.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.55 77.72% 558868.13 536592 598966 559014.23 542737 580027 33282570 33282570 0.00
crit 17.07 22.28% 1546935.25 1485287 1657939 1547279.01 1485287 1642002 26408090 26408090 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57002 (87258) 2.7% (4.1%) 20.0 15.22sec 1307304 989703 Direct 20.0 607963 1681747 854184 22.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.3210 0.0000 17099645.72 17099645.72 0.00 989703.44 989703.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.43 77.07% 607962.91 521261 680768 608048.73 557931 644153 9380002 9380002 0.00
crit 4.59 22.93% 1681746.55 1442850 1884366 1671721.83 0 1884366 7719644 7719644 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30257 1.4% 12.6 23.01sec 717403 0 Direct 12.6 510554 1414446 717414 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.64 12.64 0.00 0.00 0.0000 0.0000 9071082.30 9071082.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.75 77.11% 510553.79 437859 571845 510622.45 441774 561920 4978181 4978181 0.00
crit 2.89 22.89% 1414445.88 1211994 1582868 1351124.98 0 1582868 4092902 4092902 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 86953 4.1% 26.5 11.15sec 981244 1020265 Direct 26.5 92535 256511 130466 23.1%  
Periodic 316.7 50695 140387 71329 23.0% 133.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.55 26.55 316.66 316.66 0.9618 1.2639 26050434.92 26050434.92 0.00 61185.01 1020265.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.41 76.87% 92535.12 77837 101655 92405.36 82884 97013 1888517 1888517 0.00
crit 6.14 23.13% 256511.49 215453 281381 255270.01 0 281381 1574971 1574971 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.8 76.99% 50695.40 32 55911 50665.64 46035 53460 12359981 12359981 0.00
crit 72.8 23.01% 140386.65 88 154763 140303.92 124525 147595 10226967 10226967 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 65298 (147085) 3.0% (6.9%) 7.5 28.47sec 5762028 4916193 Direct 36.4 381723 1057114 530975 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 36.36 0.00 0.00 1.1721 0.0000 19305349.76 19305349.76 0.00 4916192.65 4916192.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.32 77.90% 381723.05 175131 1004613 382722.50 226330 620520 10811462 10811462 0.00
crit 8.03 22.10% 1057113.77 484763 2780769 1053509.91 0 2281532 8493888 8493888 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 81788 3.8% 11.2 40.24sec 2164226 0 Direct 55.0 315951 871655 439791 22.3%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 54.98 0.00 0.00 0.0000 0.0000 24183290.40 24183290.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.73 77.72% 315951.46 147109 843868 316745.59 179386 683256 13502998 13502998 0.00
crit 12.25 22.28% 871654.74 407197 2335828 875095.13 0 2335828 10680293 10680293 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162035 (263658) 7.7% (12.5%) 57.7 5.13sec 1366995 1205818 Direct 57.7 258067 840167 840146 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.68 57.68 0.00 0.00 1.1337 0.0000 48457645.57 48457645.57 0.00 1205817.56 1205817.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 258067.49 227021 296490 540.53 0 296490 541 541 0.00
crit 57.68 100.00% 840166.97 692614 1165090 840681.66 799547 894704 48457105 48457105 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83068 3.9% 36.6 8.02sec 678426 0 Direct 36.6 219199 678444 678427 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.62 36.62 0.00 0.00 0.0000 0.0000 24843492.98 24843492.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 219198.55 190698 249052 286.95 0 249052 287 287 0.00
crit 36.62 100.00% 678443.64 559584 941311 678897.99 631925 756646 24843206 24843206 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18554 0.9% 43.0 6.40sec 128921 0 Direct 99.7 44786 91330 55590 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.00 99.73 0.00 0.00 0.0000 0.0000 5543654.18 5543654.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.58 76.79% 44786.14 42943 47934 44791.17 42943 47336 3429707 3429707 0.00
crit 23.15 23.21% 91330.40 87603 97785 91346.07 87603 97785 2113947 2113947 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 49362 (96033) 2.3% (4.6%) 40.9 7.27sec 705629 581306 Direct 40.9 226844 632186 362744 33.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.93 40.93 0.00 0.00 1.2139 0.0000 14847982.87 14847982.87 0.00 581306.50 581306.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.21 66.48% 226843.55 154272 604437 227831.45 173285 380862 6172608 6172608 0.00
crit 13.72 33.52% 632186.22 427024 1673082 634345.25 443570 1265053 8675375 8675375 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 46671 2.2% 45.9 8.62sec 305633 0 Direct 45.9 191255 533375 305637 33.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.92 45.92 0.00 0.00 0.0000 0.0000 14035974.38 14035974.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.57 66.57% 191254.73 129588 507727 191642.73 144166 330177 5847159 5847159 0.00
crit 15.35 33.43% 533375.26 358700 1405389 533908.50 376118 1083074 8188815 8188815 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59970) 0.0% (2.8%) 3.0 120.33sec 5981332 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.91 0.00 0.0000 1.0000 0.00 0.00 0.00 308289.16 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19302 0.9% 38.0 6.90sec 151159 0 Direct 38.0 121869 248614 151162 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.02 38.02 0.00 0.00 0.0000 0.0000 5746330.26 5746330.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.23 76.89% 121869.49 121869 121869 121869.49 121869 121869 3562246 3562246 0.00
crit 8.79 23.11% 248613.77 248614 248614 248613.77 248614 248614 2184084 2184084 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40668 1.9% 99.0 2.62sec 122359 0 Direct 99.0 98655 201256 122358 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.95 98.95 0.00 0.00 0.0000 0.0000 12107620.13 12107620.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.09 76.90% 98654.92 98655 98655 98654.92 98655 98655 7506737 7506737 0.00
crit 22.86 23.10% 201256.04 201256 201256 201256.04 201256 201256 4600883 4600883 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143217 / 55317
Fire Blast 143217 2.6% 63.1 4.28sec 261060 145807 Direct 63.1 212307 424628 261058 23.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.12 63.12 0.00 0.00 1.7905 0.0000 16477352.71 16477352.71 0.00 145806.96 145806.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.62 77.04% 212307.29 199011 222144 212304.91 207639 220068 10323279 10323279 0.00
crit 14.49 22.96% 424627.80 398022 444288 424628.36 412258 444288 6154073 6154073 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 185132 / 25118
Lightning Blast 185132 1.2% 40.0 7.06sec 188433 200927 Direct 40.0 153752 307659 188436 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.98 39.98 0.00 0.00 0.9378 0.0000 7533961.46 7533961.46 0.00 200927.07 200927.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.97 77.47% 153751.75 147415 164551 153798.90 148976 161760 4762093 4762093 0.00
crit 9.01 22.53% 307658.71 294831 329102 307731.34 294831 329102 2771868 2771868 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
tgt_eq
Ascendance 2.0 181.63sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0340 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.19sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8143 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5091 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 15.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.07% 32.07% 3.1(3.1) 7.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.6sec 25.7sec 31.70% 31.70% 1.3(1.3) 9.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.7sec 31.54% 31.54% 1.3(1.3) 9.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.5sec 30.61% 30.61% 1.6(1.6) 9.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 78.5 28.7 3.8sec 2.8sec 73.73% 68.30% 28.7(28.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:20.92%
  • elemental_focus_2:52.81%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 24.4 7.1 11.9sec 9.1sec 25.52% 42.73% 7.2(7.2) 1.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.52%

Trigger Attempt Success

  • trigger_pct:99.82%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.76% 29.76% 4.3(4.3) 12.6

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 86.4sec 86.4sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:79.41%
Nefarious Pact 3.4 0.0 69.5sec 69.5sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 209.4sec 0.0sec 39.81% 39.81% 0.0(0.0) 1.7

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.2 2.5 45.9sec 31.6sec 31.52% 38.62% 2.5(6.0) 2.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.87%
  • power_of_the_maelstrom_2:7.12%
  • power_of_the_maelstrom_3:18.53%

Trigger Attempt Success

  • trigger_pct:15.07%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.2 0.0 44.5sec 44.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:9.99%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.8sec 62.1sec 11.30% 9.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.09%
  • stormkeeper_2:3.62%
  • stormkeeper_3:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 31.6 9.1sec
Lava Surge: Wasted 7.3 30.5sec
Lava Surge: During Lava Burst 4.4 53.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6140.00116.65816.0090.14120.097
Fire Elemental0.3210.0011.2490.0930.0001.249
Ascendance1.8660.0019.1541.6530.0009.154
Lava Burst2.9030.00134.54044.1149.34395.792
Elemental Blast2.1280.00120.86535.66117.88670.287

Resources

Resource Usage Type Count Total Average RPE APR
tgt_eq
earth_shock Maelstrom 77.2 9160.1 118.6 913.3 2197.2
earthquake Maelstrom 388.6 19431.2 50.0 385.1 12205.2
flame_shock Maelstrom 204.5 3870.4 18.9 145.8 6730.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 444.17 5274.36 (16.07%) 11.87 55.65 1.04%
Lava Burst Overload Maelstrom 282.00 2471.36 (7.53%) 8.76 66.63 2.63%
Lava Beam Maelstrom 58.12 1637.74 (4.99%) 28.18 42.12 2.51%
Lava Beam Overload Maelstrom 86.05 1618.22 (4.93%) 18.81 75.49 4.46%
Chain Lightning Maelstrom 344.08 7979.02 (24.31%) 23.19 146.35 1.80%
Chain Lightning Overload Maelstrom 414.91 6956.39 (21.19%) 16.77 391.54 5.33%
Lightning Bolt Maelstrom 315.21 2512.50 (7.66%) 7.97 9.16 0.36%
Lightning Bolt Overload Maelstrom 353.62 2100.63 (6.40%) 5.94 21.10 0.99%
Resonance Totem Maelstrom 2299.72 2270.98 (6.92%) 0.99 28.74 1.25%
Resource RPS-Gain RPS-Loss
Maelstrom 14.21 14.05
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.05 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data tgt_eq Fight Length
Count 7639
Mean 300.01
Minimum 239.93
Maximum 360.06
Spread ( max - min ) 120.13
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.0704
5th Percentile 245.95
95th Percentile 354.05
( 95th Percentile - 5th Percentile ) 108.10
Mean Distribution
Standard Deviation 0.4013
95.00% Confidence Intervall ( 299.22 - 300.79 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 525
0.1% Error 52496
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1050
DPS
Sample Data tgt_eq Damage Per Second
Count 7639
Mean 2113648.50
Minimum 1748737.18
Maximum 2704566.87
Spread ( max - min ) 955829.69
Range [ ( max - min ) / 2 * 100% ] 22.61%
Standard Deviation 112937.7825
5th Percentile 1935835.35
95th Percentile 2303484.51
( 95th Percentile - 5th Percentile ) 367649.16
Mean Distribution
Standard Deviation 1292.1740
95.00% Confidence Intervall ( 2111115.89 - 2116181.12 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 10968
0.1 Scale Factor Error with Delta=300 108883528
0.05 Scale Factor Error with Delta=300 435534109
0.01 Scale Factor Error with Delta=300 10888352716
Priority Target DPS
Sample Data tgt_eq Priority Target Damage Per Second
Count 7639
Mean 967034.56
Minimum 804250.32
Maximum 1142210.04
Spread ( max - min ) 337959.71
Range [ ( max - min ) / 2 * 100% ] 17.47%
Standard Deviation 41957.8551
5th Percentile 900889.31
95th Percentile 1039517.86
( 95th Percentile - 5th Percentile ) 138628.54
Mean Distribution
Standard Deviation 480.0595
95.00% Confidence Intervall ( 966093.67 - 967975.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7232
0.1 Scale Factor Error with Delta=300 15028313
0.05 Scale Factor Error with Delta=300 60113252
0.01 Scale Factor Error with Delta=300 1502831282
DPS(e)
Sample Data tgt_eq Damage Per Second (Effective)
Count 7639
Mean 2113648.50
Minimum 1748737.18
Maximum 2704566.87
Spread ( max - min ) 955829.69
Range [ ( max - min ) / 2 * 100% ] 22.61%
Damage
Sample Data tgt_eq Damage
Count 7639
Mean 609173031.19
Minimum 425043159.85
Maximum 831054120.39
Spread ( max - min ) 406010960.54
Range [ ( max - min ) / 2 * 100% ] 33.32%
DTPS
Sample Data tgt_eq Damage Taken Per Second
Count 7639
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data tgt_eq Healing Per Second
Count 7639
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data tgt_eq Healing Per Second (Effective)
Count 7639
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data tgt_eq Heal
Count 7639
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data tgt_eq Healing Taken Per Second
Count 7639
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data tgt_eq Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data tgt_eqTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data tgt_eq Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.98 totem_mastery,if=buff.resonance_totem.remains<2
9 1.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.95 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.88 stormkeeper
G 0.15 ascendance
0.00 liquid_magma_totem
H 2.03 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.80 earthquake
J 1.66 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.69 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.45 lava_beam
M 35.95 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.82 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.02 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.76 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.17 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.77 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.04 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 55.44 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.16 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.75 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.02 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.23 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.80 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.80 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRddWVPWWTWWWWWWIILIIILLIISWWWXXbWbbbTWcScccQWIIMMIIMISWWXXbWbXbWSTbddWFIMIMIMIMMIMSWWWWTWXMMWSbbTWQWWMIIMMIMISWW8ccAcTWbbWbbSTWQWMFIMIMMIIJHHKMJWddddTdddWWSQWHIMIMIMMHHHIJIKWbRbWbbWWTWWPWHL97FILILSWWWVTbbbWWSdddQdWIIMIMMIIMIS8WWcAccTcWbSbQbIMIMFIMIISWWWdddTWdWSbbQbIIMMIIMMSWWdd

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.939 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.693 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.447 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.203 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.958 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.711 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.465 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:08.221 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:08.221 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:08.975 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:09.729 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:10.483 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.239 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.994 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.748 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.504 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:14.259 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:15.513 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:16.471 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:17.431 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:18.708 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:19.647 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:20.586 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:21.529 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:22.782 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.849 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.650 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.450 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:26.514 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.315 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:28.078 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.115 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.894 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.672 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.710 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.491 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.526 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.562 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.599 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.377 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.412 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.499 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.598 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.685 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.771 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.182 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.242 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.654 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.714 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.774 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.185 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.598 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.659 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.697 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.080 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.118 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.501 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.822 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.169 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.179 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.171 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.491 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.483 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.804 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.796 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.117 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.500 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:09.883 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.892 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.237 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.583 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:14.502 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:15.422 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:16.177 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:16.930 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:17.684 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:18.439 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:19.194 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:19.950 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:20.704 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:21.459 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:22.444 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:23.426 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:24.180 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:25.162 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:26.144 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:27.389 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:29.048 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:30.294 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:31.541 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:32.789 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:34.036 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.096 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.507 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:37.489 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:38.471 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:39.453 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:40.389 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:41.327 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:42.080 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:42.834 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:43.589 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:44.343 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:45.262 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:46.180 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:46.933 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:47.687 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:49.270 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:50.853 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:52.099 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:53.759 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:55.005 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:56.667 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:57.422 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:58.402 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:59.157 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:00.137 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:01.121 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:01.121 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:02.103 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:02.857 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:03.609 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:04.591 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:05.573 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:06.556 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:07.540 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:08.502 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:10.289 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:11.456 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:12.623 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:13.788 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:15.370 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:16.954 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.965 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.977 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.988 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.000 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.061 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.121 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:24.159 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:25.198 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:25.953 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:26.707 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:27.462 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:28.423 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:29.384 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:30.138 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:31.074 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:31.994 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:32.913 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:33.833 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:34.752 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:35.507 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:36.424 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:37.341 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:38.894 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:40.115 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:41.741 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
2:43.369 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:44.616 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.676 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.737 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.797 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.208 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.269 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.680 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.740 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.152 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.563 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.621 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.682 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.741 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:59.494 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:00.249 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.006 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.987 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:02.971 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:03.907 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.660 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:05.578 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:06.333 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:07.250 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:08.168 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:09.088 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:09.842 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:10.596 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:11.785 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:13.367 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:13.367 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:15.028 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:16.276 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:17.937 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:19.246 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.246 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:20.306 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:21.344 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:22.727 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:23.764 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:25.148 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:26.533 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:27.592 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:29.005 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:30.418 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:31.479 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:32.539 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:33.598 Waiting     0.200 sec 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom movement, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:33.798 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:35.210 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:36.620 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:37.680 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:39.092 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:40.054 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:41.016 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:41.979 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:42.941 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:43.696 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:44.658 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:45.414 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:46.168 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:46.923 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:47.908 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:48.662 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:49.646 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:50.629 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:51.876 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:53.124 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:54.785 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:56.032 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:57.693 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:58.488 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.497 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.845 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.190 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.190 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:03.537 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:04.883 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:05.895 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.241 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:08.587 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.999 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.410 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.822 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.882 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.294 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.354 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.826 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.237 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.361 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.422 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.461 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.498 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.538 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.920 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.304 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.650 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.660 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.671 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.680 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.025 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.035 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.046 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.393 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.805 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.328 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.740 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.152 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.212 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.622 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.680 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.741 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.151 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.562 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.621 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.681 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.741 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.150 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.562 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:57.500 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:58.420 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:59.338 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="tgt_eq"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:5:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Simulation & Raid Information

Iterations: 7749
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 1359890542
Max Event Queue: 78
Sim Seconds: 2324746
CPU Seconds: 572.7969
Physical Seconds: 75.6727
Speed Up: 4059

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
1ilevel 1ilevel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.62sec 0 300.01sec
1ilevel 1ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel chain_lightning 188443 60311774 201036 35.17 244609 675039 44.7 175.8 22.9% 0.0% 0.0% 0.0% 5.95sec 60311774 300.01sec
1ilevel 1ilevel chain_lightning_overload 45297 71141595 237135 47.88 211845 584040 54.1 239.4 22.9% 0.0% 0.0% 0.0% 8.90sec 71141595 300.01sec
1ilevel 1ilevel earth_shock 8042 20172071 67239 2.01 1422225 3944738 10.1 10.1 23.0% 0.0% 0.0% 0.0% 29.93sec 20172071 300.01sec
1ilevel 1ilevel earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.54sec 0 300.01sec
1ilevel 1ilevel earthquake_ 77478 171102958 570334 307.02 79938 221315 299.4 1535.1 22.3% 0.0% 0.0% 0.0% 0.93sec 171102958 300.01sec
1ilevel 1ilevel seismic_lightning 243073 60156183 200517 15.38 560840 1552599 76.9 76.9 22.3% 0.0% 0.0% 0.0% 4.16sec 60156183 300.01sec
1ilevel 1ilevel elemental_blast 117014 17175602 57251 4.01 609841 1689360 20.0 20.0 22.9% 0.0% 0.0% 0.0% 15.23sec 17175602 300.01sec
1ilevel 1ilevel elemental_blast_overload 120588 9102731 30342 2.53 512551 1417528 12.7 12.7 22.9% 0.0% 0.0% 0.0% 23.15sec 9102731 300.01sec
1ilevel 1ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel flame_shock 188389 3454830 11516 5.28 92861 257598 26.4 26.4 23.0% 0.0% 0.0% 0.0% 11.39sec 26074348 300.01sec
1ilevel 1ilevel flame_shock ticks -188389 22619518 75398 63.21 50888 140857 26.4 316.1 23.0% 0.0% 0.0% 0.0% 11.39sec 26074348 300.01sec
1ilevel 1ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel lava_beam 114074 19339303 64463 7.27 383457 1052410 7.6 36.4 22.2% 0.0% 0.0% 0.0% 28.44sec 19339303 300.01sec
1ilevel 1ilevel lava_beam_overload 114738 24372208 81239 11.01 317224 879640 11.2 55.1 22.3% 0.0% 0.0% 0.0% 40.26sec 24372208 300.01sec
1ilevel 1ilevel lava_burst 51505 48614047 162044 11.53 264653 843242 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.13sec 48614047 300.01sec
1ilevel 1ilevel lava_burst_overload 77451 24933614 83111 7.32 222885 680925 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.05sec 24933614 300.01sec
1ilevel 1ilevel volcanic_inferno 205533 5554912 18516 19.91 44938 91642 43.2 99.6 23.2% 0.0% 0.0% 0.0% 6.28sec 5554912 300.01sec
1ilevel 1ilevel lightning_bolt 188196 14950327 49834 8.21 227690 633334 41.0 41.0 33.7% 0.0% 0.0% 0.0% 7.15sec 14950327 300.01sec
1ilevel 1ilevel lightning_bolt_overload 45284 14113545 47044 9.20 192245 534611 46.0 46.0 33.4% 0.0% 0.0% 0.0% 8.51sec 14113545 300.01sec
1ilevel 1ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.34sec 0 300.01sec
1ilevel 1ilevel spectral_blast 246442 5760560 19202 7.62 121869 248614 38.1 38.1 23.1% 0.0% 0.0% 0.0% 6.92sec 5760560 300.01sec
1ilevel 1ilevel spectral_bolt 242571 12136195 40453 19.83 98655 201256 99.2 99.2 23.1% 0.0% 0.0% 0.0% 2.61sec 12136195 300.01sec
1ilevel 1ilevel stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.20sec 0 300.01sec
1ilevel 1ilevel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.01sec
1ilevel 1ilevel_primal_fire_elemental fire_blast 57984 16548260 143560 32.91 213041 426166 63.2 63.2 22.9% 0.0% 0.0% 0.0% 4.27sec 16548260 115.27sec
1ilevel 1ilevel_greater_lightning_elemental lightning_blast 191726 7573228 185770 58.88 154315 308731 40.0 40.0 22.6% 0.0% 0.0% 0.0% 7.05sec 7573228 40.77sec
2ilevel 2ilevel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.48sec 0 300.01sec
2ilevel 2ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel chain_lightning 188443 60419713 201395 35.17 245217 677480 44.7 175.8 22.8% 0.0% 0.0% 0.0% 5.95sec 60419713 300.01sec
2ilevel 2ilevel chain_lightning_overload 45297 71315065 237713 47.87 212507 585651 54.1 239.3 22.9% 0.0% 0.0% 0.0% 8.85sec 71315065 300.01sec
2ilevel 2ilevel earth_shock 8042 20249888 67498 2.01 1428350 3946237 10.0 10.0 23.5% 0.0% 0.0% 0.0% 29.91sec 20249888 300.01sec
2ilevel 2ilevel earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.54sec 0 300.01sec
2ilevel 2ilevel earthquake_ 77478 172037083 573447 307.65 80207 222080 299.8 1538.3 22.3% 0.0% 0.0% 0.0% 0.93sec 172037083 300.01sec
2ilevel 2ilevel seismic_lightning 243073 60467204 201554 15.41 562900 1557962 77.0 77.0 22.3% 0.0% 0.0% 0.0% 4.11sec 60467204 300.01sec
2ilevel 2ilevel elemental_blast 117014 17205069 57349 4.00 612581 1693977 20.0 20.0 22.8% 0.0% 0.0% 0.0% 15.21sec 17205069 300.01sec
2ilevel 2ilevel elemental_blast_overload 120588 9163018 30543 2.53 514230 1425437 12.7 12.7 23.0% 0.0% 0.0% 0.0% 22.90sec 9163018 300.01sec
2ilevel 2ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel flame_shock 188389 3477443 11591 5.29 93239 258418 26.5 26.5 23.1% 0.0% 0.0% 0.0% 11.35sec 26210270 300.01sec
2ilevel 2ilevel flame_shock ticks -188389 22732827 75776 63.23 51081 141398 26.5 316.2 23.1% 0.0% 0.0% 0.0% 11.35sec 26210270 300.01sec
2ilevel 2ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel lava_beam 114074 19525329 65083 7.28 385538 1068358 7.6 36.4 22.1% 0.0% 0.0% 0.0% 28.42sec 19525329 300.01sec
2ilevel 2ilevel lava_beam_overload 114738 24454591 81514 10.98 319872 884991 11.2 54.9 22.2% 0.0% 0.0% 0.0% 39.51sec 24454591 300.01sec
2ilevel 2ilevel lava_burst 51505 48763604 162542 11.52 259578 846540 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.15sec 48763604 300.01sec
2ilevel 2ilevel lava_burst_overload 77451 25056262 83519 7.33 220432 683709 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.08sec 25056262 300.01sec
2ilevel 2ilevel volcanic_inferno 205533 5564919 18549 19.86 45120 92004 42.9 99.3 23.3% 0.0% 0.0% 0.0% 6.35sec 5564919 300.01sec
2ilevel 2ilevel lightning_bolt 188196 14966934 49889 8.20 228649 634903 41.0 41.0 33.6% 0.0% 0.0% 0.0% 7.18sec 14966934 300.01sec
2ilevel 2ilevel lightning_bolt_overload 45284 14125554 47084 9.18 192655 536832 45.9 45.9 33.4% 0.0% 0.0% 0.0% 8.53sec 14125554 300.01sec
2ilevel 2ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.32sec 0 300.01sec
2ilevel 2ilevel spectral_blast 246442 5760959 19203 7.62 121869 248614 38.1 38.1 23.2% 0.0% 0.0% 0.0% 6.90sec 5760959 300.01sec
2ilevel 2ilevel spectral_bolt 242571 12112675 40375 19.80 98655 201256 99.0 99.0 23.1% 0.0% 0.0% 0.0% 2.62sec 12112675 300.01sec
2ilevel 2ilevel stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.31sec 0 300.01sec
2ilevel 2ilevel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.62sec 0 300.01sec
2ilevel 2ilevel_primal_fire_elemental fire_blast 57984 16600219 144278 32.92 213819 427657 63.1 63.1 23.0% 0.0% 0.0% 0.0% 4.28sec 16600219 115.06sec
2ilevel 2ilevel_greater_lightning_elemental lightning_blast 191726 7589425 186271 58.92 154874 309858 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.04sec 7589425 40.74sec
3ilevel 3ilevel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.74sec 0 299.99sec
3ilevel 3ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
3ilevel 3ilevel chain_lightning 188443 60723995 202421 35.16 246363 680445 44.6 175.8 22.8% 0.0% 0.0% 0.0% 6.02sec 60723995 299.99sec
3ilevel 3ilevel chain_lightning_overload 45297 71676372 238930 47.88 213182 588613 54.0 239.4 23.0% 0.0% 0.0% 0.0% 9.00sec 71676372 299.99sec
3ilevel 3ilevel earth_shock 8042 20392990 67979 2.01 1433110 3965165 10.0 10.0 23.6% 0.0% 0.0% 0.0% 29.91sec 20392990 299.99sec
3ilevel 3ilevel earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.55sec 0 299.99sec
3ilevel 3ilevel earthquake_ 77478 172765831 575907 307.66 80552 223011 299.8 1538.3 22.3% 0.0% 0.0% 0.0% 0.93sec 172765831 299.99sec
3ilevel 3ilevel seismic_lightning 243073 60643011 202151 15.39 565188 1564354 77.0 77.0 22.3% 0.0% 0.0% 0.0% 4.17sec 60643011 299.99sec
3ilevel 3ilevel elemental_blast 117014 17322004 57742 4.01 614809 1701829 20.0 20.0 23.0% 0.0% 0.0% 0.0% 15.18sec 17322004 299.99sec
3ilevel 3ilevel elemental_blast_overload 120588 9197498 30659 2.53 516371 1429485 12.7 12.7 23.0% 0.0% 0.0% 0.0% 22.96sec 9197498 299.99sec
3ilevel 3ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
3ilevel 3ilevel flame_shock 188389 3507236 11691 5.30 93587 259443 26.5 26.5 23.4% 0.0% 0.0% 0.0% 11.28sec 26346980 299.99sec
3ilevel 3ilevel flame_shock ticks -188389 22839744 76132 63.27 51284 141960 26.5 316.4 23.1% 0.0% 0.0% 0.0% 11.28sec 26346980 299.99sec
3ilevel 3ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
3ilevel 3ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
3ilevel 3ilevel lava_beam 114074 19598874 65332 7.28 386536 1072616 7.6 36.4 22.2% 0.0% 0.0% 0.0% 28.49sec 19598874 299.99sec
3ilevel 3ilevel lava_beam_overload 114738 24530618 81772 11.01 320635 882631 11.2 55.0 22.2% 0.0% 0.0% 0.0% 39.98sec 24530618 299.99sec
3ilevel 3ilevel lava_burst 51505 49031643 163445 11.54 265077 849657 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.14sec 49031643 299.99sec
3ilevel 3ilevel lava_burst_overload 77451 25154258 83851 7.33 227369 686233 36.7 36.7 100.0% 0.0% 0.0% 0.0% 8.04sec 25154258 299.99sec
3ilevel 3ilevel volcanic_inferno 205533 5590558 18636 19.91 45281 92315 43.1 99.6 23.1% 0.0% 0.0% 0.0% 6.42sec 5590558 299.99sec
3ilevel 3ilevel lightning_bolt 188196 15058777 50198 8.20 229707 638988 41.0 41.0 33.6% 0.0% 0.0% 0.0% 7.14sec 15058777 299.99sec
3ilevel 3ilevel lightning_bolt_overload 45284 14234634 47450 9.20 193920 538026 46.0 46.0 33.6% 0.0% 0.0% 0.0% 8.53sec 14234634 299.99sec
3ilevel 3ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
3ilevel 3ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.32sec 0 299.99sec
3ilevel 3ilevel spectral_blast 246442 5754497 19182 7.61 121869 248614 38.0 38.0 23.2% 0.0% 0.0% 0.0% 6.90sec 5754497 299.99sec
3ilevel 3ilevel spectral_bolt 242571 12116587 40390 19.81 98655 201256 99.1 99.1 23.1% 0.0% 0.0% 0.0% 2.61sec 12116587 299.99sec
3ilevel 3ilevel stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.07sec 0 299.99sec
3ilevel 3ilevel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.61sec 0 299.99sec
3ilevel 3ilevel_primal_fire_elemental fire_blast 57984 16668885 144824 32.93 214632 429236 63.2 63.2 23.0% 0.0% 0.0% 0.0% 4.27sec 16668885 115.10sec
3ilevel 3ilevel_greater_lightning_elemental lightning_blast 191726 7643222 187319 58.95 155455 310962 40.1 40.1 22.6% 0.0% 0.0% 0.0% 7.04sec 7643222 40.80sec
baseline baseline ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.72sec 0 300.00sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline chain_lightning 188443 60093531 200314 35.17 243699 673784 44.6 175.9 22.8% 0.0% 0.0% 0.0% 6.03sec 60093531 300.00sec
baseline baseline chain_lightning_overload 45297 70748642 235831 47.81 210885 581910 53.9 239.1 22.9% 0.0% 0.0% 0.0% 9.01sec 70748642 300.00sec
baseline baseline earth_shock 8042 20126160 67088 2.00 1417118 3924713 10.0 10.0 23.6% 0.0% 0.0% 0.0% 30.05sec 20126160 300.00sec
baseline baseline earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.56sec 0 300.00sec
baseline baseline earthquake_ 77478 170565047 568556 307.30 79650 220500 299.7 1536.5 22.3% 0.0% 0.0% 0.0% 0.93sec 170565047 300.00sec
baseline baseline seismic_lightning 243073 59756610 199191 15.33 558892 1546828 76.7 76.7 22.3% 0.0% 0.0% 0.0% 4.17sec 59756610 300.00sec
baseline baseline elemental_blast 117014 17159741 57200 4.01 607884 1682452 20.0 20.0 23.2% 0.0% 0.0% 0.0% 15.21sec 17159741 300.00sec
baseline baseline elemental_blast_overload 120588 9087959 30294 2.53 510783 1412677 12.7 12.7 23.0% 0.0% 0.0% 0.0% 23.14sec 9087959 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline flame_shock 188389 3459975 11533 5.30 92528 256545 26.5 26.5 23.2% 0.0% 0.0% 0.0% 11.27sec 26007322 300.00sec
baseline baseline flame_shock ticks -188389 22547347 75158 63.23 50690 140367 26.5 316.1 23.0% 0.0% 0.0% 0.0% 11.27sec 26007322 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline lava_beam 114074 19344921 64484 7.29 381165 1053115 7.6 36.5 22.2% 0.0% 0.0% 0.0% 28.42sec 19344921 300.00sec
baseline baseline lava_beam_overload 114738 24191098 80638 10.98 316405 873459 11.2 54.9 22.3% 0.0% 0.0% 0.0% 39.84sec 24191098 300.00sec
baseline baseline lava_burst 51505 48390999 161305 11.52 269280 840160 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.13sec 48390999 300.00sec
baseline baseline lava_burst_overload 77451 24808279 82695 7.31 221121 678582 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.09sec 24808279 300.00sec
baseline baseline volcanic_inferno 205533 5537418 18458 19.92 44791 91340 43.0 99.6 23.2% 0.0% 0.0% 0.0% 6.41sec 5537418 300.00sec
baseline baseline lightning_bolt 188196 14893952 49647 8.21 226604 632569 41.0 41.0 33.6% 0.0% 0.0% 0.0% 7.08sec 14893952 300.00sec
baseline baseline lightning_bolt_overload 45284 14055524 46852 9.20 191796 531748 46.0 46.0 33.5% 0.0% 0.0% 0.0% 8.42sec 14055524 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.34sec 0 300.00sec
baseline baseline spectral_blast 246442 5761498 19205 7.60 121869 248614 38.0 38.0 23.4% 0.0% 0.0% 0.0% 6.84sec 5761498 300.00sec
baseline baseline spectral_bolt 242571 12086104 40287 19.76 98655 201256 98.8 98.8 23.1% 0.0% 0.0% 0.0% 2.61sec 12086104 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.27sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.63sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 16436494 143004 32.91 212291 424572 63.0 63.0 22.8% 0.0% 0.0% 0.0% 4.27sec 16436494 114.94sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 7546244 185024 58.94 153726 307515 40.1 40.1 22.5% 0.0% 0.0% 0.0% 7.04sec 7546244 40.79sec
ctt_nature ctt_nature ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.66sec 0 300.01sec
ctt_nature ctt_nature augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature chain_lightning 188443 60459065 201522 35.05 246099 679739 44.5 175.3 22.8% 0.0% 0.0% 0.0% 6.02sec 60459065 300.01sec
ctt_nature ctt_nature chain_lightning_overload 45297 71095832 236976 47.63 212823 587500 53.8 238.2 22.9% 0.0% 0.0% 0.0% 9.04sec 71095832 300.01sec
ctt_nature ctt_nature earth_shock 8042 20251822 67503 2.01 1430993 3964791 10.0 10.0 23.2% 0.0% 0.0% 0.0% 30.09sec 20251822 300.01sec
ctt_nature ctt_nature earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.57sec 0 300.01sec
ctt_nature ctt_nature earthquake_ 77478 170485388 568260 307.24 79627 220450 299.3 1536.3 22.3% 0.0% 0.0% 0.0% 0.93sec 170485388 300.01sec
ctt_nature ctt_nature seismic_lightning 243073 60509397 201689 15.39 564200 1561562 76.9 76.9 22.3% 0.0% 0.0% 0.0% 4.14sec 60509397 300.01sec
ctt_nature ctt_nature elemental_blast 117014 17292309 57639 4.00 613676 1698920 20.0 20.0 23.0% 0.0% 0.0% 0.0% 15.20sec 17292309 300.01sec
ctt_nature ctt_nature elemental_blast_overload 120588 9147580 30491 2.53 515472 1428119 12.6 12.6 22.9% 0.0% 0.0% 0.0% 23.24sec 9147580 300.01sec
ctt_nature ctt_nature fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature flame_shock 188389 3457567 11525 5.30 92544 256525 26.5 26.5 23.2% 0.0% 0.0% 0.0% 11.28sec 26033244 300.01sec
ctt_nature ctt_nature flame_shock ticks -188389 22575677 75252 63.30 50708 140356 26.5 316.5 23.0% 0.0% 0.0% 0.0% 11.28sec 26033244 300.01sec
ctt_nature ctt_nature flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature lava_beam 114074 19327479 64422 7.28 381659 1050843 7.6 36.4 22.3% 0.0% 0.0% 0.0% 28.82sec 19327479 300.01sec
ctt_nature ctt_nature lava_beam_overload 114738 24181940 80603 11.00 316168 873362 11.2 55.0 22.2% 0.0% 0.0% 0.0% 40.99sec 24181940 300.01sec
ctt_nature ctt_nature lava_burst 51505 48550649 161829 11.56 257641 840239 57.8 57.8 100.0% 0.0% 0.0% 0.0% 5.10sec 48550649 300.01sec
ctt_nature ctt_nature lava_burst_overload 77451 24919685 83062 7.34 216977 678674 36.7 36.7 100.0% 0.0% 0.0% 0.0% 7.99sec 24919685 300.01sec
ctt_nature ctt_nature volcanic_inferno 205533 5592951 18642 20.10 44806 91372 43.2 100.5 23.3% 0.0% 0.0% 0.0% 6.32sec 5592951 300.01sec
ctt_nature ctt_nature lightning_bolt 188196 15036089 50118 8.22 229228 637410 41.1 41.1 33.4% 0.0% 0.0% 0.0% 7.17sec 15036089 300.01sec
ctt_nature ctt_nature lightning_bolt_overload 45284 14235380 47449 9.22 193254 536902 46.1 46.1 33.6% 0.0% 0.0% 0.0% 8.53sec 14235380 300.01sec
ctt_nature ctt_nature potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ctt_nature ctt_nature spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.01sec
ctt_nature ctt_nature spectral_blast 246442 5755721 19185 7.62 121869 248614 38.1 38.1 23.1% 0.0% 0.0% 0.0% 6.87sec 5755721 300.01sec
ctt_nature ctt_nature spectral_bolt 242571 12105068 40348 19.79 98655 201256 99.0 99.0 23.1% 0.0% 0.0% 0.0% 2.61sec 12105068 300.01sec
ctt_nature ctt_nature stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.15sec 0 300.01sec
ctt_nature ctt_nature totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.01sec
ctt_nature ctt_nature_primal_fire_elemental fire_blast 57984 16478391 143126 32.89 212285 424562 63.1 63.1 23.0% 0.0% 0.0% 0.0% 4.26sec 16478391 115.13sec
ctt_nature ctt_nature_greater_lightning_elemental lightning_blast 191726 7528383 184666 58.82 153731 307666 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.03sec 7528383 40.77sec
ea_es ea_es ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.72sec 0 300.02sec
ea_es ea_es augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es chain_lightning 188443 59937262 199777 35.15 243257 671383 44.6 175.8 22.8% 0.0% 0.0% 0.0% 5.96sec 59937262 300.02sec
ea_es ea_es chain_lightning_overload 45297 70468633 234879 47.72 210910 580271 53.9 238.6 22.8% 0.0% 0.0% 0.0% 8.98sec 70468633 300.02sec
ea_es ea_es earth_shock 8042 20815546 69380 2.00 1465254 4062228 10.0 10.0 23.5% 0.0% 0.0% 0.0% 30.22sec 20815546 300.02sec
ea_es ea_es earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.55sec 0 300.02sec
ea_es ea_es earthquake_ 77478 170583428 568572 307.45 79621 220447 299.8 1537.4 22.3% 0.0% 0.0% 0.0% 0.93sec 170583428 300.02sec
ea_es ea_es seismic_lightning 243073 59824754 199402 15.37 558774 1546442 76.9 76.9 22.2% 0.0% 0.0% 0.0% 4.13sec 59824754 300.02sec
ea_es ea_es elemental_blast 117014 17123211 57073 4.00 607974 1683005 20.0 20.0 23.1% 0.0% 0.0% 0.0% 15.22sec 17123211 300.02sec
ea_es ea_es elemental_blast_overload 120588 9069276 30229 2.52 510624 1414237 12.6 12.6 23.0% 0.0% 0.0% 0.0% 23.31sec 9069276 300.02sec
ea_es ea_es fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es flame_shock 188389 3455188 11516 5.29 92545 256606 26.4 26.4 23.3% 0.0% 0.0% 0.0% 11.30sec 26004589 300.02sec
ea_es ea_es flame_shock ticks -188389 22549401 75165 63.23 50714 140412 26.4 316.2 23.0% 0.0% 0.0% 0.0% 11.30sec 26004589 300.02sec
ea_es ea_es flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es lava_beam 114074 19278052 64256 7.28 380990 1053611 7.6 36.4 22.1% 0.0% 0.0% 0.0% 28.67sec 19278052 300.02sec
ea_es ea_es lava_beam_overload 114738 24145225 80478 11.03 314441 868358 11.2 55.1 22.3% 0.0% 0.0% 0.0% 40.87sec 24145225 300.02sec
ea_es ea_es lava_burst 51505 48479155 161586 11.54 255025 840198 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.12sec 48479155 300.02sec
ea_es ea_es lava_burst_overload 77451 24854313 82842 7.33 223512 678554 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.04sec 24854313 300.02sec
ea_es ea_es volcanic_inferno 205533 5575090 18582 20.08 44792 91308 43.1 100.4 23.1% 0.0% 0.0% 0.0% 6.27sec 5575090 300.02sec
ea_es ea_es lightning_bolt 188196 14910664 49699 8.21 227228 632613 41.0 41.0 33.6% 0.0% 0.0% 0.0% 7.20sec 14910664 300.02sec
ea_es ea_es lightning_bolt_overload 45284 14031882 46770 9.18 191676 533107 45.9 45.9 33.4% 0.0% 0.0% 0.0% 8.57sec 14031882 300.02sec
ea_es ea_es potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.02sec
ea_es ea_es spectral_blast 246442 5758063 19192 7.62 121869 248614 38.1 38.1 23.1% 0.0% 0.0% 0.0% 6.84sec 5758063 300.02sec
ea_es ea_es spectral_bolt 242571 12113284 40375 19.80 98655 201256 99.0 99.0 23.1% 0.0% 0.0% 0.0% 2.61sec 12113284 300.02sec
ea_es ea_es stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.08sec 0 300.02sec
ea_es ea_es totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.02sec
ea_es ea_es_primal_fire_elemental fire_blast 57984 16456619 142927 32.90 212278 424524 63.1 63.1 22.8% 0.0% 0.0% 0.0% 4.27sec 16456619 115.14sec
ea_es ea_es_greater_lightning_elemental lightning_blast 191726 7534322 184856 58.87 153753 307651 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.06sec 7534322 40.76sec
ede_crit ede_crit ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.72sec 0 300.00sec
ede_crit ede_crit augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit chain_lightning 188443 60482864 201611 35.10 243927 685486 44.6 175.5 22.8% 0.0% 0.0% 0.0% 6.04sec 60482864 300.00sec
ede_crit ede_crit chain_lightning_overload 45297 71042251 236809 47.66 210799 592751 53.8 238.3 22.9% 0.0% 0.0% 0.0% 8.99sec 71042251 300.00sec
ede_crit ede_crit earth_shock 8042 20248302 67495 2.01 1416968 3990710 10.0 10.0 23.4% 0.0% 0.0% 0.0% 29.94sec 20248302 300.00sec
ede_crit ede_crit earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.58sec 0 300.00sec
ede_crit ede_crit earthquake_ 77478 171935443 573122 307.26 79642 224653 299.5 1536.3 22.3% 0.0% 0.0% 0.0% 0.93sec 171935443 300.00sec
ede_crit ede_crit seismic_lightning 243073 60280688 200937 15.35 558823 1576034 76.8 76.8 22.3% 0.0% 0.0% 0.0% 4.16sec 60280688 300.00sec
ede_crit ede_crit elemental_blast 117014 17272477 57575 4.01 608005 1714192 20.0 20.0 23.0% 0.0% 0.0% 0.0% 15.20sec 17272477 300.00sec
ede_crit ede_crit elemental_blast_overload 120588 9138359 30461 2.53 510648 1440789 12.6 12.6 22.9% 0.0% 0.0% 0.0% 23.51sec 9138359 300.00sec
ede_crit ede_crit fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit flame_shock 188389 3482342 11608 5.29 92538 261372 26.4 26.4 23.2% 0.0% 0.0% 0.0% 11.23sec 26208924 300.00sec
ede_crit ede_crit flame_shock ticks -188389 22726582 75755 63.20 50702 143007 26.4 316.0 23.0% 0.0% 0.0% 0.0% 11.23sec 26208924 300.00sec
ede_crit ede_crit flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit lava_beam 114074 19463779 64880 7.28 381549 1071478 7.6 36.4 22.2% 0.0% 0.0% 0.0% 28.51sec 19463779 300.00sec
ede_crit ede_crit lava_beam_overload 114738 24516722 81723 10.99 317587 894999 11.2 54.9 22.3% 0.0% 0.0% 0.0% 40.28sec 24516722 300.00sec
ede_crit ede_crit lava_burst 51505 49358668 164530 11.52 267258 856708 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.12sec 49358668 300.00sec
ede_crit ede_crit lava_burst_overload 77451 25256860 84190 7.32 221191 690544 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.04sec 25256860 300.00sec
ede_crit ede_crit volcanic_inferno 205533 5557896 18526 20.01 44784 91328 43.1 100.0 23.2% 0.0% 0.0% 0.0% 6.38sec 5557896 300.00sec
ede_crit ede_crit lightning_bolt 188196 15076017 50254 8.24 226479 642213 41.2 41.2 33.5% 0.0% 0.0% 0.0% 7.10sec 15076017 300.00sec
ede_crit ede_crit lightning_bolt_overload 45284 14278061 47594 9.26 191037 540720 46.3 46.3 33.6% 0.0% 0.0% 0.0% 8.43sec 14278061 300.00sec
ede_crit ede_crit potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.34sec 0 300.00sec
ede_crit ede_crit spectral_blast 246442 5755819 19186 7.61 121869 248614 38.0 38.0 23.3% 0.0% 0.0% 0.0% 6.88sec 5755819 300.00sec
ede_crit ede_crit spectral_bolt 242571 12128375 40428 19.83 98655 201256 99.2 99.2 23.1% 0.0% 0.0% 0.0% 2.61sec 12128375 300.00sec
ede_crit ede_crit stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.15sec 0 300.00sec
ede_crit ede_crit totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.00sec
ede_crit ede_crit_primal_fire_elemental fire_blast 57984 16496973 143151 32.91 212283 424490 63.2 63.2 22.9% 0.0% 0.0% 0.0% 4.26sec 16496973 115.24sec
ede_crit ede_crit_greater_lightning_elemental lightning_blast 191726 7537277 185000 58.85 153754 307627 40.0 40.0 22.7% 0.0% 0.0% 0.0% 7.04sec 7537277 40.74sec
edi_cl edi_cl ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.68sec 0 300.01sec
edi_cl edi_cl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl chain_lightning 188443 62534575 208445 35.17 253867 701043 44.7 175.8 22.8% 0.0% 0.0% 0.0% 6.02sec 62534575 300.01sec
edi_cl edi_cl chain_lightning_overload 45297 73424012 244742 47.70 219555 605078 53.9 238.5 22.9% 0.0% 0.0% 0.0% 9.02sec 73424012 300.01sec
edi_cl edi_cl earth_shock 8042 20137250 67123 2.01 1417879 3924074 10.0 10.0 23.4% 0.0% 0.0% 0.0% 29.69sec 20137250 300.01sec
edi_cl edi_cl earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.60sec 0 300.01sec
edi_cl edi_cl earthquake_ 77478 170527607 568415 307.36 79625 220475 299.3 1536.8 22.2% 0.0% 0.0% 0.0% 0.94sec 170527607 300.01sec
edi_cl edi_cl seismic_lightning 243073 59843257 199474 15.37 558740 1546488 76.8 76.8 22.3% 0.0% 0.0% 0.0% 4.16sec 59843257 300.01sec
edi_cl edi_cl elemental_blast 117014 17094879 56982 4.00 607889 1682988 20.0 20.0 22.9% 0.0% 0.0% 0.0% 15.23sec 17094879 300.01sec
edi_cl edi_cl elemental_blast_overload 120588 9073142 30243 2.52 510601 1414335 12.6 12.6 23.0% 0.0% 0.0% 0.0% 23.19sec 9073142 300.01sec
edi_cl edi_cl fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl flame_shock 188389 3458912 11530 5.30 92554 256467 26.5 26.5 23.2% 0.0% 0.0% 0.0% 11.21sec 26027281 300.01sec
edi_cl edi_cl flame_shock ticks -188389 22568369 75228 63.29 50716 140367 26.5 316.5 23.0% 0.0% 0.0% 0.0% 11.21sec 26027281 300.01sec
edi_cl edi_cl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl lava_beam 114074 20126538 67087 7.29 397600 1096090 7.6 36.4 22.1% 0.0% 0.0% 0.0% 28.47sec 20126538 300.01sec
edi_cl edi_cl lava_beam_overload 114738 25238443 84127 11.04 328611 906224 11.2 55.2 22.3% 0.0% 0.0% 0.0% 40.09sec 25238443 300.01sec
edi_cl edi_cl lava_burst 51505 48473060 161574 11.54 269250 839990 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.10sec 48473060 300.01sec
edi_cl edi_cl lava_burst_overload 77451 24879727 82931 7.34 222470 678305 36.7 36.7 100.0% 0.0% 0.0% 0.0% 7.98sec 24879727 300.01sec
edi_cl edi_cl volcanic_inferno 205533 5577214 18590 20.06 44796 91331 43.3 100.3 23.2% 0.0% 0.0% 0.0% 6.35sec 5577214 300.01sec
edi_cl edi_cl lightning_bolt 188196 14841131 49470 8.20 226874 631263 41.0 41.0 33.4% 0.0% 0.0% 0.0% 7.15sec 14841131 300.01sec
edi_cl edi_cl lightning_bolt_overload 45284 14062219 46873 9.19 191367 533185 45.9 45.9 33.6% 0.0% 0.0% 0.0% 8.50sec 14062219 300.01sec
edi_cl edi_cl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.31sec 0 300.01sec
edi_cl edi_cl spectral_blast 246442 5752578 19175 7.61 121869 248614 38.0 38.0 23.2% 0.0% 0.0% 0.0% 6.91sec 5752578 300.01sec
edi_cl edi_cl spectral_bolt 242571 12106194 40353 19.80 98655 201256 99.0 99.0 23.0% 0.0% 0.0% 0.0% 2.61sec 12106194 300.01sec
edi_cl edi_cl stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.16sec 0 300.01sec
edi_cl edi_cl totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.59sec 0 300.01sec
edi_cl edi_cl_primal_fire_elemental fire_blast 57984 16473048 143064 32.90 212255 424558 63.1 63.1 22.9% 0.0% 0.0% 0.0% 4.27sec 16473048 115.14sec
edi_cl edi_cl_greater_lightning_elemental lightning_blast 191726 7525561 184709 58.84 153769 307609 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.03sec 7525561 40.74sec
fs_fs fs_fs ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.53sec 0 300.01sec
fs_fs fs_fs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs chain_lightning 188443 60062759 200200 35.14 243477 674267 44.6 175.7 22.8% 0.0% 0.0% 0.0% 5.99sec 60062759 300.01sec
fs_fs fs_fs chain_lightning_overload 45297 70589344 235287 47.87 210345 579602 54.1 239.4 22.9% 0.0% 0.0% 0.0% 8.92sec 70589344 300.01sec
fs_fs fs_fs earth_shock 8042 20233284 67441 2.02 1417090 3922285 10.1 10.1 23.6% 0.0% 0.0% 0.0% 30.00sec 20233284 300.01sec
fs_fs fs_fs earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.55sec 0 300.01sec
fs_fs fs_fs earthquake_ 77478 170842753 569451 307.72 79655 220501 299.9 1538.7 22.3% 0.0% 0.0% 0.0% 0.93sec 170842753 300.01sec
fs_fs fs_fs seismic_lightning 243073 59762125 199198 15.35 558922 1546917 76.7 76.7 22.3% 0.0% 0.0% 0.0% 4.17sec 59762125 300.01sec
fs_fs fs_fs elemental_blast 117014 17086221 56952 4.00 607744 1682421 20.0 20.0 22.8% 0.0% 0.0% 0.0% 15.22sec 17086221 300.01sec
fs_fs fs_fs elemental_blast_overload 120588 9126308 30420 2.54 510509 1413605 12.7 12.7 23.1% 0.0% 0.0% 0.0% 23.02sec 9126308 300.01sec
fs_fs fs_fs fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs flame_shock 188389 3645185 12150 5.27 98153 271959 26.4 26.4 23.1% 0.0% 0.0% 0.0% 11.38sec 27515410 300.01sec
fs_fs fs_fs flame_shock ticks -188389 23870225 79567 63.10 53780 148898 26.4 315.5 23.0% 0.0% 0.0% 0.0% 11.38sec 27515410 300.01sec
fs_fs fs_fs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs lava_beam 114074 19354807 64513 7.29 381317 1051752 7.6 36.4 22.3% 0.0% 0.0% 0.0% 28.37sec 19354807 300.01sec
fs_fs fs_fs lava_beam_overload 114738 24551197 81834 11.12 316923 873922 11.3 55.6 22.3% 0.0% 0.0% 0.0% 40.46sec 24551197 300.01sec
fs_fs fs_fs lava_burst 51505 48381650 161265 11.52 262763 840128 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.17sec 48381650 300.01sec
fs_fs fs_fs lava_burst_overload 77451 24868194 82890 7.33 225467 678507 36.7 36.7 100.0% 0.0% 0.0% 0.0% 8.09sec 24868194 300.01sec
fs_fs fs_fs volcanic_inferno 205533 5538715 18462 19.94 44789 91334 43.1 99.7 23.1% 0.0% 0.0% 0.0% 6.34sec 5538715 300.01sec
fs_fs fs_fs lightning_bolt 188196 14918544 49726 8.22 226992 631745 41.1 41.1 33.6% 0.0% 0.0% 0.0% 7.10sec 14918544 300.01sec
fs_fs fs_fs lightning_bolt_overload 45284 14144626 47147 9.24 191880 533240 46.2 46.2 33.4% 0.0% 0.0% 0.0% 8.40sec 14144626 300.01sec
fs_fs fs_fs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
fs_fs fs_fs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.34sec 0 300.01sec
fs_fs fs_fs spectral_blast 246442 5754488 19181 7.61 121869 248614 38.0 38.0 23.2% 0.0% 0.0% 0.0% 6.90sec 5754488 300.01sec
fs_fs fs_fs spectral_bolt 242571 12100627 40334 19.77 98655 201256 98.8 98.8 23.2% 0.0% 0.0% 0.0% 2.60sec 12100627 300.01sec
fs_fs fs_fs stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.05sec 0 300.01sec
fs_fs fs_fs totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.62sec 0 300.01sec
fs_fs fs_fs_primal_fire_elemental fire_blast 57984 16457184 143050 32.89 212297 424605 63.1 63.1 22.9% 0.0% 0.0% 0.0% 4.29sec 16457184 115.04sec
fs_fs fs_fs_greater_lightning_elemental lightning_blast 191726 7529205 184686 58.79 153753 307668 39.9 39.9 22.6% 0.0% 0.0% 0.0% 7.06sec 7529205 40.77sec
li_lvb li_lvb ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.74sec 0 300.02sec
li_lvb li_lvb augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
li_lvb li_lvb chain_lightning 188443 60032940 200095 35.22 243366 671405 44.7 176.1 22.8% 0.0% 0.0% 0.0% 6.02sec 60032940 300.02sec
li_lvb li_lvb chain_lightning_overload 45297 70542412 235124 47.79 210342 581000 54.0 239.0 22.9% 0.0% 0.0% 0.0% 8.98sec 70542412 300.02sec
li_lvb li_lvb earth_shock 8042 20139986 67128 2.01 1418868 3924138 10.0 10.0 23.5% 0.0% 0.0% 0.0% 29.75sec 20139986 300.02sec
li_lvb li_lvb earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.58sec 0 300.02sec
li_lvb li_lvb earthquake_ 77478 170740667 569095 307.62 79653 220538 299.7 1538.2 22.2% 0.0% 0.0% 0.0% 0.93sec 170740667 300.02sec
li_lvb li_lvb seismic_lightning 243073 59828670 199415 15.35 558856 1546885 76.8 76.8 22.3% 0.0% 0.0% 0.0% 4.17sec 59828670 300.02sec
li_lvb li_lvb elemental_blast 117014 17132935 57106 4.00 608037 1682263 20.0 20.0 23.1% 0.0% 0.0% 0.0% 15.19sec 17132935 300.02sec
li_lvb li_lvb elemental_blast_overload 120588 9066875 30221 2.53 510683 1414314 12.6 12.6 22.9% 0.0% 0.0% 0.0% 23.12sec 9066875 300.02sec
li_lvb li_lvb fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
li_lvb li_lvb flame_shock 188389 3476722 11588 5.31 92545 256574 26.5 26.5 23.5% 0.0% 0.0% 0.0% 11.20sec 26042583 300.02sec
li_lvb li_lvb flame_shock ticks -188389 22565861 75220 63.28 50712 140387 26.5 316.4 23.0% 0.0% 0.0% 0.0% 11.20sec 26042583 300.02sec
li_lvb li_lvb flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
li_lvb li_lvb food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
li_lvb li_lvb lava_beam 114074 19280726 64264 7.27 382170 1051722 7.6 36.4 22.1% 0.0% 0.0% 0.0% 28.48sec 19280726 300.02sec
li_lvb li_lvb lava_beam_overload 114738 24250347 80829 11.03 315797 874037 11.2 55.1 22.2% 0.0% 0.0% 0.0% 40.02sec 24250347 300.02sec
li_lvb li_lvb lava_burst 51505 49833717 166100 11.55 276716 862981 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.11sec 49833717 300.02sec
li_lvb li_lvb lava_burst_overload 77451 25602486 85335 7.35 230878 696854 36.7 36.7 100.0% 0.0% 0.0% 0.0% 7.98sec 25602486 300.02sec
li_lvb li_lvb volcanic_inferno 205533 5579400 18597 20.06 44786 91316 43.3 100.3 23.3% 0.0% 0.0% 0.0% 6.23sec 5579400 300.02sec
li_lvb li_lvb lightning_bolt 188196 14826854 49419 8.17 227251 632241 40.8 40.8 33.5% 0.0% 0.0% 0.0% 7.18sec 14826854 300.02sec
li_lvb li_lvb lightning_bolt_overload 45284 14069279 46894 9.17 191628 534479 45.8 45.8 33.6% 0.0% 0.0% 0.0% 8.54sec 14069279 300.02sec
li_lvb li_lvb potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
li_lvb li_lvb spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.02sec
li_lvb li_lvb spectral_blast 246442 5734545 19114 7.59 121869 248614 38.0 38.0 23.1% 0.0% 0.0% 0.0% 6.92sec 5734545 300.02sec
li_lvb li_lvb spectral_bolt 242571 12099838 40330 19.78 98655 201256 98.9 98.9 23.1% 0.0% 0.0% 0.0% 2.62sec 12099838 300.02sec
li_lvb li_lvb stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.01sec 0 300.02sec
li_lvb li_lvb totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.62sec 0 300.02sec
li_lvb li_lvb_primal_fire_elemental fire_blast 57984 16452104 143063 32.92 212304 424640 63.1 63.1 22.8% 0.0% 0.0% 0.0% 4.28sec 16452104 115.00sec
li_lvb li_lvb_greater_lightning_elemental lightning_blast 191726 7552998 185256 59.00 153752 307738 40.1 40.1 22.5% 0.0% 0.0% 0.0% 7.03sec 7552998 40.77sec
mb_lvs mb_lvs ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.66sec 0 300.00sec
mb_lvs mb_lvs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs chain_lightning 188443 59933232 199779 35.11 243638 672402 44.5 175.5 22.8% 0.0% 0.0% 0.0% 6.00sec 59933232 300.00sec
mb_lvs mb_lvs chain_lightning_overload 45297 70554696 235185 47.77 210588 580811 53.9 238.9 22.9% 0.0% 0.0% 0.0% 8.97sec 70554696 300.00sec
mb_lvs mb_lvs earth_shock 8042 20159367 67199 2.01 1417960 3931223 10.0 10.0 23.5% 0.0% 0.0% 0.0% 29.95sec 20159367 300.00sec
mb_lvs mb_lvs earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.58sec 0 300.00sec
mb_lvs mb_lvs earthquake_ 77478 170621808 568745 307.48 79645 220489 299.6 1537.4 22.3% 0.0% 0.0% 0.0% 0.93sec 170621808 300.00sec
mb_lvs mb_lvs seismic_lightning 243073 59924110 199749 15.38 558885 1546721 76.9 76.9 22.3% 0.0% 0.0% 0.0% 4.16sec 59924110 300.00sec
mb_lvs mb_lvs elemental_blast 117014 17141028 57137 4.00 607820 1681925 20.0 20.0 23.2% 0.0% 0.0% 0.0% 15.24sec 17141028 300.00sec
mb_lvs mb_lvs elemental_blast_overload 120588 9041591 30139 2.52 510675 1413256 12.6 12.6 22.8% 0.0% 0.0% 0.0% 23.09sec 9041591 300.00sec
mb_lvs mb_lvs fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs flame_shock 188389 3455013 11517 5.29 92545 256431 26.4 26.4 23.3% 0.0% 0.0% 0.0% 11.23sec 25997804 300.00sec
mb_lvs mb_lvs flame_shock ticks -188389 22542791 75143 63.18 50700 140355 26.4 315.9 23.0% 0.0% 0.0% 0.0% 11.23sec 25997804 300.00sec
mb_lvs mb_lvs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs lava_beam 114074 19245565 64153 7.28 381012 1050307 7.6 36.4 22.1% 0.0% 0.0% 0.0% 28.54sec 19245565 300.00sec
mb_lvs mb_lvs lava_beam_overload 114738 24366962 81224 11.04 316375 876972 11.2 55.2 22.3% 0.0% 0.0% 0.0% 40.52sec 24366962 300.00sec
mb_lvs mb_lvs lava_burst 51505 49554368 165183 11.53 259608 859915 57.6 57.6 100.0% 0.0% 0.0% 0.0% 5.13sec 49554368 300.00sec
mb_lvs mb_lvs lava_burst_overload 77451 25243150 84145 7.33 215571 688386 36.7 36.7 100.0% 0.0% 0.0% 0.0% 8.06sec 25243150 300.00sec
mb_lvs mb_lvs volcanic_inferno 205533 5511172 18371 19.83 44791 91331 42.9 99.1 23.2% 0.0% 0.0% 0.0% 6.34sec 5511172 300.00sec
mb_lvs mb_lvs lightning_bolt 188196 14927915 49760 8.23 227248 630268 41.2 41.2 33.6% 0.0% 0.0% 0.0% 7.17sec 14927915 300.00sec
mb_lvs mb_lvs lightning_bolt_overload 45284 14118147 47061 9.21 191514 534447 46.1 46.1 33.5% 0.0% 0.0% 0.0% 8.56sec 14118147 300.00sec
mb_lvs mb_lvs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.00sec
mb_lvs mb_lvs spectral_blast 246442 5744235 19148 7.60 121869 248614 38.0 38.0 23.1% 0.0% 0.0% 0.0% 6.90sec 5744235 300.00sec
mb_lvs mb_lvs spectral_bolt 242571 12102179 40341 19.80 98655 201256 99.0 99.0 23.0% 0.0% 0.0% 0.0% 2.61sec 12102179 300.00sec
mb_lvs mb_lvs stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.07sec 0 300.00sec
mb_lvs mb_lvs totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.62sec 0 300.00sec
mb_lvs mb_lvs_primal_fire_elemental fire_blast 57984 16476390 143120 32.89 212347 424685 63.1 63.1 23.0% 0.0% 0.0% 0.0% 4.27sec 16476390 115.12sec
mb_lvs mb_lvs_greater_lightning_elemental lightning_blast 191726 7542468 184934 58.89 153747 307603 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.06sec 7542468 40.78sec
tgt_eq tgt_eq ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.63sec 0 300.01sec
tgt_eq tgt_eq augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq chain_lightning 188443 60089477 200295 35.17 243756 672083 44.7 175.8 22.9% 0.0% 0.0% 0.0% 5.97sec 60089477 300.01sec
tgt_eq tgt_eq chain_lightning_overload 45297 70503024 235006 47.71 210726 581595 53.9 238.5 22.9% 0.0% 0.0% 0.0% 8.96sec 70503024 300.01sec
tgt_eq tgt_eq earth_shock 8042 20126318 67087 2.01 1417959 3919110 10.0 10.0 23.5% 0.0% 0.0% 0.0% 30.31sec 20126318 300.01sec
tgt_eq tgt_eq earthquake 61882 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 5.56sec 0 300.01sec
tgt_eq tgt_eq earthquake_ 77478 177471048 591560 306.90 82980 229734 299.3 1534.5 22.3% 0.0% 0.0% 0.0% 0.93sec 177471048 300.01sec
tgt_eq tgt_eq seismic_lightning 243073 59690661 198965 15.32 558868 1546935 76.6 76.6 22.3% 0.0% 0.0% 0.0% 4.16sec 59690661 300.01sec
tgt_eq tgt_eq elemental_blast 117014 17099646 56998 4.00 607963 1681747 20.0 20.0 22.9% 0.0% 0.0% 0.0% 15.22sec 17099646 300.01sec
tgt_eq tgt_eq elemental_blast_overload 120588 9071082 30236 2.53 510554 1414446 12.6 12.6 22.9% 0.0% 0.0% 0.0% 23.01sec 9071082 300.01sec
tgt_eq tgt_eq fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq flame_shock 188389 3463488 11545 5.31 92535 256511 26.5 26.5 23.1% 0.0% 0.0% 0.0% 11.15sec 26050435 300.01sec
tgt_eq tgt_eq flame_shock ticks -188389 22586947 75290 63.33 50695 140387 26.5 316.7 23.0% 0.0% 0.0% 0.0% 11.15sec 26050435 300.01sec
tgt_eq tgt_eq flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq lava_beam 114074 19305350 64350 7.27 381723 1057114 7.5 36.4 22.1% 0.0% 0.0% 0.0% 28.47sec 19305350 300.01sec
tgt_eq tgt_eq lava_beam_overload 114738 24183290 80610 11.00 315951 871655 11.2 55.0 22.3% 0.0% 0.0% 0.0% 40.24sec 24183290 300.01sec
tgt_eq tgt_eq lava_burst 51505 48457646 161523 11.54 258067 840167 57.7 57.7 100.0% 0.0% 0.0% 0.0% 5.13sec 48457646 300.01sec
tgt_eq tgt_eq lava_burst_overload 77451 24843493 82810 7.32 219199 678444 36.6 36.6 100.0% 0.0% 0.0% 0.0% 8.02sec 24843493 300.01sec
tgt_eq tgt_eq volcanic_inferno 205533 5543654 18479 19.94 44786 91330 43.0 99.7 23.2% 0.0% 0.0% 0.0% 6.40sec 5543654 300.01sec
tgt_eq tgt_eq lightning_bolt 188196 14847983 49492 8.19 226844 632186 40.9 40.9 33.5% 0.0% 0.0% 0.0% 7.27sec 14847983 300.01sec
tgt_eq tgt_eq lightning_bolt_overload 45284 14035974 46786 9.18 191255 533375 45.9 45.9 33.4% 0.0% 0.0% 0.0% 8.62sec 14035974 300.01sec
tgt_eq tgt_eq potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.01sec
tgt_eq tgt_eq spectral_blast 246442 5746330 19154 7.60 121869 248614 38.0 38.0 23.1% 0.0% 0.0% 0.0% 6.90sec 5746330 300.01sec
tgt_eq tgt_eq spectral_bolt 242571 12107620 40358 19.79 98655 201256 99.0 99.0 23.1% 0.0% 0.0% 0.0% 2.62sec 12107620 300.01sec
tgt_eq tgt_eq stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.19sec 0 300.01sec
tgt_eq tgt_eq totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.01sec
tgt_eq tgt_eq_primal_fire_elemental fire_blast 57984 16477353 143127 32.90 212307 424628 63.1 63.1 23.0% 0.0% 0.0% 0.0% 4.28sec 16477353 115.12sec
tgt_eq tgt_eq_greater_lightning_elemental lightning_blast 191726 7533961 184843 58.86 153752 307659 40.0 40.0 22.5% 0.0% 0.0% 0.0% 7.06sec 7533961 40.76sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
946246.2 946246.2 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.15% 10.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.15%

Trigger Attempt Success

  • trigger_pct:95.35%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.23% 10.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.23%

Trigger Attempt Success

  • trigger_pct:99.99%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.23% 10.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.17% 11.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.29% 11.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.53% 11.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.98% 11.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.87% 10.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.73% 7.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.81% 4.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 946246.24
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 91367
Mean 300.01
Minimum 239.92
Maximum 360.07
Spread ( max - min ) 120.15
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.0606
5th Percentile 245.80
95th Percentile 354.20
( 95th Percentile - 5th Percentile ) 108.40
Mean Distribution
Standard Deviation 0.1160
95.00% Confidence Intervall ( 299.78 - 300.23 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 525
0.1% Error 52466
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1050
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 91367
Mean 967990.15
Minimum 804250.32
Maximum 1194374.91
Spread ( max - min ) 390124.59
Range [ ( max - min ) / 2 * 100% ] 20.15%
Standard Deviation 42322.2773
5th Percentile 901135.73
95th Percentile 1040089.99
( 95th Percentile - 5th Percentile ) 138954.26
Mean Distribution
Standard Deviation 140.0149
95.00% Confidence Intervall ( 967715.73 - 968264.58 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7344
0.1 Scale Factor Error with Delta=300 15290502
0.05 Scale Factor Error with Delta=300 61162006
0.01 Scale Factor Error with Delta=300 1529050132
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330926691 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 322731.59
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Beast1 Fight Length
Count 91367
Mean 45.05
Minimum 15.00
Maximum 83.90
Spread ( max - min ) 68.90
Range [ ( max - min ) / 2 * 100% ] 76.47%
Standard Deviation 7.9202
5th Percentile 32.11
95th Percentile 58.01
( 95th Percentile - 5th Percentile ) 25.90
Mean Distribution
Standard Deviation 0.0262
95.00% Confidence Intervall ( 45.00 - 45.10 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1188
0.1% Error 118738
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 3
0.01 Scale Factor Error with Delta=300 54
DPS
Sample Data Beast1 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Beast1 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Beast1 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Beast1 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Beast1 Damage Taken Per Second
Count 91367
Mean 319811.47
Minimum 25993.61
Maximum 896208.76
Spread ( max - min ) 870215.15
Range [ ( max - min ) / 2 * 100% ] 136.05%
HPS
Sample Data Beast1 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Beast1 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Beast1 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Beast1 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Beast1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear1
Resource RPS-Gain RPS-Loss
Health 0.00 88339.71
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear1 Fight Length
Count 91367
Mean 215.63
Minimum 169.92
Maximum 260.07
Spread ( max - min ) 90.15
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 26.2240
5th Percentile 175.80
95th Percentile 255.00
( 95th Percentile - 5th Percentile ) 79.20
Mean Distribution
Standard Deviation 0.0868
95.00% Confidence Intervall ( 215.46 - 215.80 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 569
0.1% Error 56816
0.1 Scale Factor Error with Delta=300 6
0.05 Scale Factor Error with Delta=300 24
0.01 Scale Factor Error with Delta=300 588
DPS
Sample Data Heavy_Spear1 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear1 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Heavy_Spear1 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear1 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear1 Damage Taken Per Second
Count 91367
Mean 88483.34
Minimum 0.00
Maximum 300076.33
Spread ( max - min ) 300076.33
Range [ ( max - min ) / 2 * 100% ] 169.57%
HPS
Sample Data Heavy_Spear1 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Heavy_Spear1 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear1 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear1 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Heavy_Spear1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Heavy_Spear1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear2
Resource RPS-Gain RPS-Loss
Health 0.00 88328.81
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear2 Fight Length
Count 91367
Mean 215.63
Minimum 169.92
Maximum 260.07
Spread ( max - min ) 90.15
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 26.2240
5th Percentile 175.80
95th Percentile 255.00
( 95th Percentile - 5th Percentile ) 79.20
Mean Distribution
Standard Deviation 0.0868
95.00% Confidence Intervall ( 215.46 - 215.80 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 569
0.1% Error 56816
0.1 Scale Factor Error with Delta=300 6
0.05 Scale Factor Error with Delta=300 24
0.01 Scale Factor Error with Delta=300 588
DPS
Sample Data Heavy_Spear2 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear2 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Heavy_Spear2 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear2 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear2 Damage Taken Per Second
Count 91367
Mean 88446.94
Minimum 0.00
Maximum 343548.85
Spread ( max - min ) 343548.85
Range [ ( max - min ) / 2 * 100% ] 194.21%
HPS
Sample Data Heavy_Spear2 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Heavy_Spear2 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear2 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear2 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Heavy_Spear2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Heavy_Spear2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear2"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 501025.04
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast1 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast1 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast1 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast1 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast1 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast1 Damage Taken Per Second
Count 91367
Mean 501411.33
Minimum 267472.40
Maximum 895265.47
Spread ( max - min ) 627793.07
Range [ ( max - min ) / 2 * 100% ] 62.60%
HPS
Sample Data Pack_Beast1 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast1 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast1 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast1 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast2
Resource RPS-Gain RPS-Loss
Health 0.00 484858.71
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast2 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast2 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast2 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast2 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast2 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast2 Damage Taken Per Second
Count 91367
Mean 485402.84
Minimum 265169.84
Maximum 793159.82
Spread ( max - min ) 527989.98
Range [ ( max - min ) / 2 * 100% ] 54.39%
HPS
Sample Data Pack_Beast2 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast2 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast2 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast2 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast2"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast3
Resource RPS-Gain RPS-Loss
Health 0.00 484615.21
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast3 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast3 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast3 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast3 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast3 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast3 Damage Taken Per Second
Count 91367
Mean 485184.73
Minimum 277902.39
Maximum 801148.86
Spread ( max - min ) 523246.47
Range [ ( max - min ) / 2 * 100% ] 53.92%
HPS
Sample Data Pack_Beast3 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast3 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast3 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast3 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast3"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast4
Resource RPS-Gain RPS-Loss
Health 0.00 484633.30
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast4 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast4 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast4 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast4 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast4 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast4 Damage Taken Per Second
Count 91367
Mean 485174.91
Minimum 259831.71
Maximum 812908.72
Spread ( max - min ) 553077.01
Range [ ( max - min ) / 2 * 100% ] 57.00%
HPS
Sample Data Pack_Beast4 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast4 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast4 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast4 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast4"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast5
Resource RPS-Gain RPS-Loss
Health 0.00 484703.54
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast5 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast5 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast5 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast5 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast5 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast5 Damage Taken Per Second
Count 91367
Mean 485257.90
Minimum 267511.93
Maximum 784864.27
Spread ( max - min ) 517352.34
Range [ ( max - min ) / 2 * 100% ] 53.31%
HPS
Sample Data Pack_Beast5 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast5 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast5 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast5 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast5"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast6 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast6
Resource RPS-Gain RPS-Loss
Health 0.00 485417.65
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast6 Fight Length
Count 91367
Mean 98.35
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 12.0354
5th Percentile 80.00
95th Percentile 119.20
( 95th Percentile - 5th Percentile ) 39.20
Mean Distribution
Standard Deviation 0.0398
95.00% Confidence Intervall ( 98.27 - 98.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57532
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 124
DPS
Sample Data Pack_Beast6 Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast6 Priority Target Damage Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast6 Damage Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast6 Damage
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast6 Damage Taken Per Second
Count 91367
Mean 485970.99
Minimum 255771.57
Maximum 814768.35
Spread ( max - min ) 558996.78
Range [ ( max - min ) / 2 * 100% ] 57.51%
HPS
Sample Data Pack_Beast6 Healing Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast6 Healing Per Second (Effective)
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast6 Heal
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast6 Healing Taken Per Second
Count 91367
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast6 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast6Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast6 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 330919567 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast6"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.